Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse liver, using SLC27A4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit anti-Mouse, Rat SLC27A4 Polyclonal Antibody | anti-SLC27A4 antibody

SLC27A4 Rabbit pAb

Gene Names
SLC27A4; IPS; FATP4; ACSVL4
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
SLC27A4; Polyclonal Antibody; SLC27A4 Rabbit pAb; ACSVL4; FATP4; IPS; anti-SLC27A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
Applicable Applications for anti-SLC27A4 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 574-643 of human SLC27A4 (NP_005085.2).
Cellular Location
Endoplasmic reticulum membrane, Membrane, Multi-pass membrane protein
Positive Samples
Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse liver, using SLC27A4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse liver, using SLC27A4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-SLC27A4 antibody
Background: This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the small intestine, and appears to be the principal fatty acid transporter in enterocytes. Clinical studies suggest this gene as a candidate gene for the insulin resistance syndrome. Mutations in this gene have been associated with ichthyosis prematurity syndrome.
Product Categories/Family for anti-SLC27A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,064 Da
NCBI Official Full Name
long-chain fatty acid transport protein 4
NCBI Official Synonym Full Names
solute carrier family 27 (fatty acid transporter), member 4
NCBI Official Symbol
SLC27A4
NCBI Official Synonym Symbols
IPS; FATP4; ACSVL4
NCBI Protein Information
long-chain fatty acid transport protein 4
UniProt Protein Name
Long-chain fatty acid transport protein 4
UniProt Gene Name
SLC27A4
UniProt Synonym Gene Names
ACSVL4; FATP4; FATP-4
UniProt Entry Name
S27A4_HUMAN

NCBI Description

This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the small intestine, and appears to be the principal fatty acid transporter in enterocytes. Clinical studies suggest this gene as a candidate gene for the insulin resistance syndrome. Mutations in this gene have been associated with ichthyosis prematurity syndrome. [provided by RefSeq, Apr 2010]

Uniprot Description

SLC27A4: Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. Defects in SLC27A4 are the cause of ichthyosis prematurity syndrome (IPS). A keratinization disorder characterized by complications in the second trimester of pregnancy resulting from polyhydramnion, with premature birth of a child with thick caseous desquamating epidermis, respiratory complications and transient eosinophilia. After recovery during the first months of life, the symptoms are relatively benign and the patients suffer from a lifelong non-scaly ichthyosis with atopic manifestations. Belongs to the ATP-dependent AMP-binding enzyme family.

Protein type: Membrane protein, multi-pass; Transporter; Membrane protein, integral; Transporter, SLC family; EC 6.2.1.-; Ligase

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: endoplasmic reticulum membrane; microvillus; membrane; brush border membrane; integral to membrane; plasma membrane

Molecular Function: fatty acid transporter activity; nucleotide binding; very-long-chain-fatty-acid-CoA ligase activity; long-chain-fatty-acid-CoA ligase activity

Biological Process: long-chain fatty acid transport; skin development; transport; very-long-chain fatty acid catabolic process; long-chain fatty acid metabolic process; lipid metabolic process; medium-chain fatty acid transport; transmembrane transport; fatty acid transport; response to nutrient

Disease: Ichthyosis Prematurity Syndrome

Research Articles on SLC27A4

Similar Products

Product Notes

The SLC27A4 slc27a4 (Catalog #AAA9142181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC27A4 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC27A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC27A4 slc27a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PLYARPIFLR LLPELHKTGT YKFQKTELRK EGFDPAIVKD PLFYLDAQKG RYVPLDQEAY SRIQAGEEKL. It is sometimes possible for the material contained within the vial of "SLC27A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.