Rabbit SLC25A24 Polyclonal Antibody | anti-SLC25A24 antibody
SLC25A24 antibody
Gene Names
Slc25a24; 2610016M12Rik
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
SLC25A24; Polyclonal Antibody; SLC25A24 antibody; Polyclonal SLC25A24; Anti-SLC25A24; Solute Carrier Family 25 Member 24; SCAMC-1; APC1; SLCA24-25; RP11-356N1.3; Mitochondrial Carrier Phosphate Carrier 24; DKFZp586G0123; SLCA24 25; anti-SLC25A24 antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC25A24 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
232
Applicable Applications for anti-SLC25A24 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SLC25A24 antibody
Rabbit polyclonal SLC25A24 antibody
Product Categories/Family for anti-SLC25A24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
45 kDa (MW of target protein)
NCBI Official Full Name
Slc25a24 protein, partial
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24
NCBI Official Symbol
Slc25a24
NCBI Official Synonym Symbols
2610016M12Rik
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-1
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-1
Protein Family
UniProt Gene Name
Slc25a24
UniProt Synonym Gene Names
Scamc1
UniProt Entry Name
SCMC1_MOUSE
Uniprot Description
SLC25A24: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Transporter, SLC family; Mitochondrial; Transporter; Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: membrane; mitochondrion; mitochondrial inner membrane; cytoplasm; integral to membrane
Molecular Function: metal ion binding; ATP transmembrane transporter activity; calcium ion binding
Biological Process: ATP transport; transport; purine nucleoside transport; transmembrane transport; mitochondrial transport
Research Articles on SLC25A24
Similar Products
Product Notes
The SLC25A24 slc25a24 (Catalog #AAA5302296) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC25A24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the SLC25A24 slc25a24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
