Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NUDT12 antibody (MBS5302437) used at 2.5 ug/ml to detect target protein.)

Rabbit NUDT12 Polyclonal Antibody | anti-NUDT12 antibody

NUDT12 antibody

Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
NUDT12; Polyclonal Antibody; NUDT12 antibody; Polyclonal NUDT12; Anti-NUDT12; NUDT 12; NUDT-12; DKFZP761I172; Nucleoside Diphosphate Linked Moiety X-Type Motif 12; Nudix 12; anti-NUDT12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NUDT12 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
462
Applicable Applications for anti-NUDT12 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
NUDT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids  LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(NUDT12 antibody (MBS5302437) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (NUDT12 antibody (MBS5302437) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-NUDT12 antibody
Rabbit polyclonal NUDT12 antibody
Product Categories/Family for anti-NUDT12 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
52 kDa (MW of target protein)
NCBI Official Full Name
NUDT12, partial
Protein Family

Similar Products

Product Notes

The NUDT12 (Catalog #AAA5302437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NUDT12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the NUDT12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NUDT12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.