Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PHACS antibody (MBS5302982) used at 2.5 ug/ml to detect target protein.)

Rabbit PHACS Polyclonal Antibody | anti-PHACS antibody

PHACS antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
PHACS; Polyclonal Antibody; PHACS antibody; Polyclonal PHACS; Anti-PHACS; ACS; anti-PHACS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PHACS antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-PHACS antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids  RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PHACS antibody (MBS5302982) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (PHACS antibody (MBS5302982) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-PHACS antibody
Rabbit polyclonal PHACS antibody
Product Categories/Family for anti-PHACS antibody

Similar Products

Product Notes

The PHACS (Catalog #AAA5302982) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHACS antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PHACS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the PHACS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHACS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.