Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- SLC22A2 Picoband antibody, MBS178391, Western blottingAll lanes: Anti SLC22A2 (MBS178391) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 63KDObserved bind size: 63KD )

SLC22A2 Polyclonal Antibody | anti-SLC22A2 antibody

Anti-SLC22A2 Antibody

Gene Names
SLC22A2; OCT2
Reactivity
Mouse, Rat
Predicted to work with: Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
SLC22A2; Polyclonal Antibody; Anti-SLC22A2 Antibody; Solute carrier family 22 member 2; MGC32628; OCT 2; OCT2; Organic cation transporter 2; Organic cation transporter; RP11-317M22.2; Solute carrier family 22 (organic cation transporter) member 2; solute carrier family 22 (organic cation transporter); member 2; anti-SLC22A2 antibody
Ordering
For Research Use Only!
Reactivity
Mouse, Rat
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
555
Applicable Applications for anti-SLC22A2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SLC22A2 Picoband antibody, MBS178391, Western blottingAll lanes: Anti SLC22A2 (MBS178391) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 63KDObserved bind size: 63KD )

Western Blot (WB) (Anti- SLC22A2 Picoband antibody, MBS178391, Western blottingAll lanes: Anti SLC22A2 (MBS178391) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 63KDObserved bind size: 63KD )

Immunohistochemistry (IHC)

(Anti- SLC22A2 Picoband antibody, MBS178391, IHC(P)IHC(P): Mouse Kidney Tissue )

Immunohistochemistry (IHC) (Anti- SLC22A2 Picoband antibody, MBS178391, IHC(P)IHC(P): Mouse Kidney Tissue )

Immunohistochemistry (IHC)

(Anti- SLC22A2 Picoband antibody, MBS178391, IHC(P)IHC(P): Rat Kidney Tissue )

Immunohistochemistry (IHC) (Anti- SLC22A2 Picoband antibody, MBS178391, IHC(P)IHC(P): Rat Kidney Tissue )
Related Product Information for anti-SLC22A2 antibody
Description: Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.
References
1. "Entrez Gene: SLC22A2 solute carrier family 22 (organic cation transporter), member 2". 2. Koehler, M. R., Wissinger, B., Gorboulev, V., Koepsell, H., Schmid, M. The two human organic cation transporter genes SLC22A1 and SLC22A2 are located on chromosome 6q26. Cytogenet. Cell Genet. 79: 198-200, 1997.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,685 Da
NCBI Official Full Name
solute carrier family 22 member 2
NCBI Official Synonym Full Names
solute carrier family 22 member 2
NCBI Official Symbol
SLC22A2
NCBI Official Synonym Symbols
OCT2
NCBI Protein Information
solute carrier family 22 member 2
UniProt Protein Name
Solute carrier family 22 member 2
Protein Family
UniProt Gene Name
SLC22A2
UniProt Synonym Gene Names
OCT2; hOCT2
UniProt Entry Name
S22A2_HUMAN

NCBI Description

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC22A2: Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: basolateral plasma membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: choline transmembrane transporter activity; dopamine transmembrane transporter activity; neurotransmitter transporter activity; organic cation transmembrane transporter activity; quaternary ammonium group transmembrane transporter activity; steroid binding

Biological Process: body fluid secretion; choline transport; dopamine transport; histamine transport; multidrug transport; neurotransmitter biosynthetic process; neurotransmitter secretion; organic cation transport; quaternary ammonium group transport

Research Articles on SLC22A2

Similar Products

Product Notes

The SLC22A2 slc22a2 (Catalog #AAA178391) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC22A2 Antibody reacts with Mouse, Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SLC22A2 slc22a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.