Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit SLC17A1 Polyclonal Antibody | anti-SLC17A1 antibody

SLC17A1 Rabbit pAb

Gene Names
SLC17A1; NPT1; NPT-1; NAPI-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
SLC17A1; Polyclonal Antibody; SLC17A1 Rabbit pAb; NAPI-1; NPT-1; NPT1; anti-SLC17A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGY
Applicable Applications for anti-SLC17A1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Customer Validation: Mouse Monocyte Macrophage Leukemia Cells
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A1 (NP_005065.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,132 Da
NCBI Official Full Name
sodium-dependent phosphate transport protein 1
NCBI Official Synonym Full Names
solute carrier family 17 (organic anion transporter), member 1
NCBI Official Symbol
SLC17A1
NCBI Official Synonym Symbols
NPT1; NPT-1; NAPI-1
NCBI Protein Information
sodium-dependent phosphate transport protein 1; na/Pi-4; Na(+)/PI cotransporter 1; sodium phosphate transporter; sodium/phosphate cotransporter 1; solute carrier family 17 member 1; sodium/phosphate type I cotransporter; renal sodium-phosphate transport p
UniProt Protein Name
Sodium-dependent phosphate transport protein 1
UniProt Gene Name
SLC17A1
UniProt Synonym Gene Names
NPT1; Renal sodium-phosphate transport protein 1
UniProt Entry Name
NPT1_HUMAN

Similar Products

Product Notes

The SLC17A1 slc17a1 (Catalog #AAA9142389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC17A1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC17A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200 Customer Validation: Mouse Monocyte Macrophage Leukemia Cells. Researchers should empirically determine the suitability of the SLC17A1 slc17a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQMDNRLPPK KVPGFCSFRY GLSFLVHCCN VIITAQRACL NLTMVVMVNS TDPHGLPNTS TKKLLDNIKN PMYNWSPDIQ GIILSSTSYG VIIIQVPVGY. It is sometimes possible for the material contained within the vial of "SLC17A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.