Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit SLC12A8 Polyclonal Antibody | anti-SLC12A8 antibody

SLC12A8 antibody

Gene Names
SLC12A8; CCC9
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC12A8; Polyclonal Antibody; SLC12A8 antibody; Polyclonal SLC12A8; Anti-SLC12A8; DKFZp686L18248; FLJ23188; SLCA8 12; Solute Carrier Family 12 Sodium/Potassium/Chloride Transporters Member 8; CCC9; Potassium/Chloride Transporters 8; SLCA8-12; anti-SLC12A8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC12A8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
714
Applicable Applications for anti-SLC12A8 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.
Cross-Reactivity
Human
Immunogen
SLC12A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SLC12A8 antibody
Rabbit polyclonal SLC12A8 antibody
Product Categories/Family for anti-SLC12A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
78 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 12 member 8
NCBI Official Synonym Full Names
solute carrier family 12, member 8
NCBI Official Symbol
SLC12A8
NCBI Official Synonym Symbols
CCC9
NCBI Protein Information
solute carrier family 12 member 8
UniProt Protein Name
Solute carrier family 12 member 8
Protein Family
UniProt Gene Name
SLC12A8
UniProt Synonym Gene Names
CCC9
UniProt Entry Name
S12A8_HUMAN

NCBI Description

This gene is thought to be a candidate for psoriasis susceptibility. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Sep 2010]

Uniprot Description

SLC12A8: Cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation. SLC12A8 has been identified as a possible susceptibility gene for psoriasis mapped to chromosome 3q21 (PSORS5). Belongs to the SLC12A transporter family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 3q21.2

Cellular Component: integral to membrane

Molecular Function: symporter activity

Biological Process: transmembrane transport; potassium ion transport

Research Articles on SLC12A8

Similar Products

Product Notes

The SLC12A8 slc12a8 (Catalog #AAA5302158) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC12A8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC12A8 slc12a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC12A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.