Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLAMF6 polyclonal antibody. Western Blot analysis of SLAMF6 expression in human spleen.)

Mouse anti-Human SLAMF6 Polyclonal Antibody | anti-SLAMF6 antibody

SLAMF6 (KALI, SLAM Family Member 6, Activating NK Receptor, NK-T-B-antigen, CD352, MGC104953, NTB-A, UNQ6123/PRO20080)

Gene Names
SLAMF6; KALI; NTBA; CD352; KALIb; Ly108; NTB-A; SF2000
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLAMF6; Polyclonal Antibody; SLAMF6 (KALI; SLAM Family Member 6; Activating NK Receptor; NK-T-B-antigen; CD352; MGC104953; NTB-A; UNQ6123/PRO20080); Anti -SLAMF6 (KALI; anti-SLAMF6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SLAMF6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPGEHSDS
Applicable Applications for anti-SLAMF6 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SLAMF6, aa1-271 (AAH90928.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SLAMF6 polyclonal antibody. Western Blot analysis of SLAMF6 expression in human spleen.)

Western Blot (WB) (SLAMF6 polyclonal antibody. Western Blot analysis of SLAMF6 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of SLAMF6 expression in transfected 293T cell line by SLAMF6 polyclonal antibody. Lane 1: SLAMF6 transfected lysate (29.81kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLAMF6 expression in transfected 293T cell line by SLAMF6 polyclonal antibody. Lane 1: SLAMF6 transfected lysate (29.81kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SLAMF6 antibody
The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-SLAMF6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,345 Da
NCBI Official Full Name
SLAM family member 6 isoform 4
NCBI Official Synonym Full Names
SLAM family member 6
NCBI Official Symbol
SLAMF6
NCBI Official Synonym Symbols
KALI; NTBA; CD352; KALIb; Ly108; NTB-A; SF2000
NCBI Protein Information
SLAM family member 6; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen
UniProt Protein Name
SLAM family member 6
Protein Family
UniProt Gene Name
SLAMF6
UniProt Synonym Gene Names
KALI; NTB-A
UniProt Entry Name
SLAF6_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, May 2010]

Uniprot Description

SLAMF6: Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.2

Cellular Component: integral to membrane; plasma membrane

Molecular Function: receptor activity

Research Articles on SLAMF6

Similar Products

Product Notes

The SLAMF6 slamf6 (Catalog #AAA6001273) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLAMF6 (KALI, SLAM Family Member 6, Activating NK Receptor, NK-T-B-antigen, CD352, MGC104953, NTB-A, UNQ6123/PRO20080) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLAMF6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SLAMF6 slamf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLWLFQSLLF VFCFGPGNVV SQSSLTPLMV NGILGESVTL PLEFPAGEKV NFITWLFNET SLAFIVPHET KSPEIHVTNP KQGKRLNFTQ SYSLQLSNLK MEDTGSYRAQ ISTKTSAKLS SYTLRILRQL RNIQVTNHSQ LFQNMTCELH LTCSVEDADD NVSFRWEALG NTLSSQPNLT VSWDPRISSE QDYTCIAENA VSNLSFSVSA QKLCEDVKIQ YTDTKMILFM VSGICIVFGF IILLLLVLRK RRDSLSLSTQ RTQGPGEHSD S. It is sometimes possible for the material contained within the vial of "SLAMF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.