Rabbit anti-Human SKP2 Polyclonal Antibody | anti-SKP2 antibody

SKP2 Antibody - middle region

Cat. Num. AAA3221488

• Gene Names: SKP2; p45; FBL1; FLB1; FBXL1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: SKP2; Polyclonal Antibody; SKP2 Antibody - middle region; anti-SKP2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPK
• Sequence Length: 424

• Applicable Applications for anti-SKP2 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SKP2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SKP2Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-SKP2 antibody

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms.

Product Categories/Family for anti-SKP2 antibody

Polyclonal; Transcription Factor; Cancer; Protein Kinases; E3 & Ubiquitin; Disease Related; Meiosis/Mitosis/Cell Cycle

NCBI and Uniprot Product Information

• NCBI GI #: 340805881
• NCBI GeneID: 6502
• NCBI Accession #: NP_001230049.1
• NCBI GenBank Nucleotide #: NM_001243120.1
• UniProt Accession #: Q13309
• Molecular Weight: 46 kDa
• NCBI Official Full Name: S-phase kinase-associated protein 2 isoform 3
• NCBI Official Synonym Full Names: S-phase kinase associated protein 2
• NCBI Official Symbol: SKP2
• NCBI Official Synonym Symbols: p45; FBL1; FLB1; FBXL1
• NCBI Protein Information: S-phase kinase-associated protein 2
• UniProt Protein Name: S-phase kinase-associated protein 2
• Protein Family: S-phase kinase-associated protein
• UniProt Gene Name: SKP2
• UniProt Synonym Gene Names: FBXL1
• UniProt Entry Name: SKP2_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2011]

Uniprot Description

SKP2: an F-box protein of the SCF (SKP1-CUL1-F- box protein) E3 ubiquitin ligase system. The F-box component of the SCF complex is responsible for recognizing different substrates for ubiquitination. The SCF E3 complex mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Three alternatively-spliced isoforms have been described.

Protein type: Ubiquitin conjugating system; Cell cycle regulation

Chromosomal Location of Human Ortholog: 5p13

Cellular Component: nucleoplasm; cytoplasm; nucleolus; SCF ubiquitin ligase complex; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; ubiquitin-protein ligase activity

Biological Process: regulation of apoptosis; cell proliferation; protein polyubiquitination; regulation of cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; positive regulation of smooth muscle cell proliferation; positive regulation of estrogen receptor signaling pathway; mitotic cell cycle; G2/M transition of mitotic cell cycle; G1/S transition of mitotic cell cycle