Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SKP1 expression in transfected 293T cell line by SKP1 polyclonal antibody. Lane 1: SKP1 transfected lysate (18.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SKP1 Polyclonal Antibody | anti-SKP1 antibody

SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1,

Gene Names
SKP1; OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SKP1; Polyclonal Antibody; SKP1 (S-phase Kinase-associated Protein 1; Cyclin-A/CDK2-associated Protein p19; Organ of Corti Protein 2; OCP-2; Organ of Corti Protein II; OCP-II; RNA Polymerase II Elongation Factor-like Protein; SIII; Transcription Elongation Factor B; p19A; p19skp1; ; anti-SKP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SKP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SKP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SKP1, aa1-160 (NP_008861.2).
Immunogen Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SKP1 expression in transfected 293T cell line by SKP1 polyclonal antibody. Lane 1: SKP1 transfected lysate (18.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SKP1 expression in transfected 293T cell line by SKP1 polyclonal antibody. Lane 1: SKP1 transfected lysate (18.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SKP1 and CACYBP. HeLa cells were stained with SKP1 rabbit purified polyclonal 1:1200 and CACYBP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SKP1 and CACYBP. HeLa cells were stained with SKP1 rabbit purified polyclonal 1:1200 and CACYBP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-SKP1 antibody
S-phase kinase-associated protein 1A (Skp1) is a component of the SCF ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. Skp1 interacts directly with cullin 1 and F-box proteins in the SCF complex. It is also involved in the control of beta-catenin levels and the activity of beta-catenin dependent TCF transcription factors.
Product Categories/Family for anti-SKP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,658 Da
NCBI Official Full Name
S-phase kinase-associated protein 1 isoform a
NCBI Official Synonym Full Names
S-phase kinase-associated protein 1
NCBI Official Symbol
SKP1
NCBI Official Synonym Symbols
OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L
NCBI Protein Information
S-phase kinase-associated protein 1; SIII; OCP-2; p19skp1; organ of Corti protein 2; organ of Corti protein II; cyclin A/CDK2-associated p19; transcription elongation factor B; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; RN
UniProt Protein Name
S-phase kinase-associated protein 1
Protein Family
UniProt Gene Name
SKP1
UniProt Synonym Gene Names
EMC19; OCP2; SKP1A; TCEB1L; OCP-2; OCP-II
UniProt Entry Name
SKP1_HUMAN

NCBI Description

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008]

Uniprot Description

SKP1A: Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(Cyclin F) directs ubiquitination of CP110. Component of an E3 ubiquitin ligase complex containing UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Component of the SCF(BTRC) complex, composed of SKP1, CUL1 and BTRC. Part of a SCF(BTRC)-like complex lacking CUL1, which is associated with phosphorylated NFKBIA and RELA; RELA interacts directly with NFKBIA. Component of the SCF(FBXO44) complex, composed of SKP1, CUL1 and FBXO44. Identified in a complex with SKP2, CKS1B and p27Kip1. Interacts with the cyclin A/CDK2 complex. Part of a SCF- like complex consisting of CUL7, RBX1, SKP1 and FBXW8. Part of several SCF complexes containing SKP1 and one of the F-box proteins. Component of a SCF(SKP2)-like complex containing CUL1, SKP1, TRIM21 and SKP2. Interacts with FBXO2, FBXO4, FBXW7 and TRIM21. Interacts with FBXO45. Component of the SCF(FBXO17) complex, composed of SKP1, CUL1 and FBXO17. Component of the SCF(FBXO27) complex, composed of SKP1, CUL1 and FBXO27. Component of the SCF(Cyclin F) complex consisting of CUL1, RBX1, SKP1 and CCNF. Belongs to the SKP1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; SCF ubiquitin ligase complex; PcG protein complex; cytosol

Molecular Function: protein binding; ubiquitin-protein ligase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; circadian rhythm; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; Notch signaling pathway; viral reproduction; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination; mitotic cell cycle; G2/M transition of mitotic cell cycle; G1/S transition of mitotic cell cycle

Research Articles on SKP1

Similar Products

Product Notes

The SKP1 skp1 (Catalog #AAA6394223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SKP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SKP1 skp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SKP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.