S-phase kinase-associated protein 1 Recombinant Protein | SKP1 recombinant protein

Recombinant Human S-phase kinase-associated protein 1

Cat. Num. AAA953870

• Gene Names: SKP1; OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: S-phase kinase-associated protein 1; Recombinant Human S-phase kinase-associated protein 1; Cyclin-A/CDK2-associated protein p19; Organ of Corti protein 2; OCP-2; Organ of Corti protein II; OCP-II; RNA polymerase II elongation factor-like protein; SIII; Transcription elongation factor B; p19A; p19skp1; SKP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-163aa; Full Length
• Sequence: PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
• Sequence Length: 163

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SKP1 recombinant protein

Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF(BTRC) and SCF(FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF(FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF(BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5 and probably NFKB2. SCF(SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF(SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF(FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF(FBXW2) directs ubiquitination of GCM1. SCF(FBXO32) directs ubiquitination of MYOD1. SCF(FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF(FBXO33) directs ubiquitination of YBX1. SCF(FBXO11) directs ubiquitination of BCL6 and DTL but does not se to direct ubiquitination of TP53. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(CCNF) directs ubiquitination of CCP110. SCF(FBXL3) and SCF(FBXL21) direct ubiquitination of CRY1 and CRY2. SCF(FBXO9) direct ubiquitination of TTI1 and TELO2. SCF(FBXO10) direct ubiquitination of BCL2.

Product Categories/Family for SKP1 recombinant protein

Cell Biology

References

p19Skp1 and p45Skp2 are essential elements of the cyclin A-CDK2 S phase kinase.Zhang H., Kobayashi R., Galaktionov K., Beach D.Cell 82:915-925(1995) A novel cDNA with homology to an RNA polymerase II elongation factors maps to human chromosome 5q31 (TCEB1L) and to mouse chromosome 11 (Tceb1l) .Sowden J., Morrison K., Schofield J., Putt W., Edwards Y.Genomics 29:145-151(1995)

NCBI and Uniprot Product Information

• NCBI GI #: 25777711
• NCBI GeneID: 6500
• NCBI Accession #: NP_008861.2
• NCBI GenBank Nucleotide #: NM_006930.3
• UniProt Accession #: P63208; P34991; Q8TAY2; D3DQ97; D3DQ98
• Molecular Weight: 45.5 kDa
• NCBI Official Full Name: S-phase kinase-associated protein 1 isoform a
• NCBI Official Synonym Full Names: S-phase kinase-associated protein 1
• NCBI Official Symbol: SKP1
• NCBI Official Synonym Symbols: OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L
• NCBI Protein Information: S-phase kinase-associated protein 1
• UniProt Protein Name: S-phase kinase-associated protein 1
• Protein Family: S-phase kinase-associated protein
• UniProt Gene Name: SKP1
• UniProt Synonym Gene Names: EMC19; OCP2; SKP1A; TCEB1L; p19A; OCP-2; OCP-II
• UniProt Entry Name: SKP1_HUMAN

NCBI Description

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008]

Uniprot Description

SKP1A: Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(Cyclin F) directs ubiquitination of CP110. Component of an E3 ubiquitin ligase complex containing UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Component of the SCF(BTRC) complex, composed of SKP1, CUL1 and BTRC. Part of a SCF(BTRC)-like complex lacking CUL1, which is associated with phosphorylated NFKBIA and RELA; RELA interacts directly with NFKBIA. Component of the SCF(FBXO44) complex, composed of SKP1, CUL1 and FBXO44. Identified in a complex with SKP2, CKS1B and p27Kip1. Interacts with the cyclin A/CDK2 complex. Part of a SCF- like complex consisting of CUL7, RBX1, SKP1 and FBXW8. Part of several SCF complexes containing SKP1 and one of the F-box proteins. Component of a SCF(SKP2)-like complex containing CUL1, SKP1, TRIM21 and SKP2. Interacts with FBXO2, FBXO4, FBXW7 and TRIM21. Interacts with FBXO45. Component of the SCF(FBXO17) complex, composed of SKP1, CUL1 and FBXO17. Component of the SCF(FBXO27) complex, composed of SKP1, CUL1 and FBXO27. Component of the SCF(Cyclin F) complex consisting of CUL1, RBX1, SKP1 and CCNF. Belongs to the SKP1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: cytoplasm; cytosol; nucleoplasm; nucleus; PcG protein complex; SCF ubiquitin ligase complex

Molecular Function: beta-catenin binding; protein binding; ubiquitin-protein ligase activity

Biological Process: anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; circadian rhythm; G1/S transition of mitotic cell cycle; G2/M transition of mitotic cell cycle; innate immune response; mitotic cell cycle; MyD88-dependent toll-like receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; Notch signaling pathway; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein ubiquitination; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; stimulatory C-type lectin receptor signaling pathway; stress-activated MAPK cascade; T cell receptor signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 2 signaling pathway; toll-like receptor 3 signaling pathway; toll-like receptor 4 signaling pathway; toll-like receptor 5 signaling pathway; toll-like receptor 9 signaling pathway; toll-like receptor signaling pathway; tumor necrosis factor-mediated signaling pathway; viral reproduction