Western Blot (WB)
Rabbit RTL10 Polyclonal Antibody | anti-RTL10 antibody
Anti-RTL10 Antibody
Gene Names
RTL10; BOP; C22orf29
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
RTL10; Polyclonal Antibody; Anti-RTL10 Antibody; Protein Bop; BH3-only protein; Retrotransposon Gag-like protein 10; BOP; C22orf29; anti-RTL10 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
364
Applicable Applications for anti-RTL10 antibody
Western Blot (WB), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.25-0.5ug/ml (Human, Mouse, Rat)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
Western Blot (WB)
Related Product Information for anti-RTL10 antibody
Description: Rabbit IgG polyclonal antibody for RTL10 detection. Tested with WB, FCM in Human; Mouse; Rat.
Background: RTL10 (Retrotransposon Gag Like 10) is a Protein Coding gene. This gene is mapped to 22q11.21. It could induce apoptosis in a BH3 domain-dependent manner. The direct interaction network of Bcl-2 family members may play a key role in modulation RTL10/BOP intrinsic apoptotic signaling activity. Diseases associated with RTL10 include Hemophagocytic Lymphohistiocytosis, Familial, 3.
Background: RTL10 (Retrotransposon Gag Like 10) is a Protein Coding gene. This gene is mapped to 22q11.21. It could induce apoptosis in a BH3 domain-dependent manner. The direct interaction network of Bcl-2 family members may play a key role in modulation RTL10/BOP intrinsic apoptotic signaling activity. Diseases associated with RTL10 include Hemophagocytic Lymphohistiocytosis, Familial, 3.
References
1. Zhang X, Weng C, Li Y, Wang X, Jiang C, Li X, Xu Y, Chen Q, Pan L, Tang H. "Human Bop is a novel BH3-only member of the Bcl-2 protein family." Protein Cell. 2012 Oct;3(10):790-801. doi: 10.1007/s13238-012-2069-7. Epub 2012 Oct 11.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein Bop
NCBI Official Synonym Full Names
retrotransposon Gag like 10
NCBI Official Symbol
RTL10
NCBI Official Synonym Symbols
BOP; C22orf29
NCBI Protein Information
protein Bop
UniProt Protein Name
Protein Bop
UniProt Gene Name
BOP
UniProt Synonym Gene Names
C22orf29
UniProt Entry Name
BOP_HUMAN
Research Articles on RTL10
Similar Products
Product Notes
The RTL10 bop (Catalog #AAA1753175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-RTL10 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RTL10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Flow Cytometry (FC/FACS). WB: 0.25-0.5ug/ml (Human, Mouse, Rat) FC/FACS: 1-3ug/1x106 cells (Human) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the RTL10 bop for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RTL10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
