Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SIX6 Polyclonal Antibody | anti-SIX6 antibody

SIX6 antibody - N-terminal region

Gene Names
SIX6; Six9; ODRMD; OPTX2; MCOPCT2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SIX6; Polyclonal Antibody; SIX6 antibody - N-terminal region; anti-SIX6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQAL
Sequence Length
246
Applicable Applications for anti-SIX6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SIX6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )
Related Product Information for anti-SIX6 antibody
This is a rabbit polyclonal antibody against SIX6. It was validated on Western Blot and immunohistochemistry

Target Description: SIX6 is a member of SIX family. It is the homologue of the chick Six6(Optx2) gene. SIX6 is closely related to SIX3 and is expressed in the developing and adult human retina.
Product Categories/Family for anti-SIX6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
homeobox protein SIX6
NCBI Official Synonym Full Names
SIX homeobox 6
NCBI Official Symbol
SIX6
NCBI Official Synonym Symbols
Six9; ODRMD; OPTX2; MCOPCT2
NCBI Protein Information
homeobox protein SIX6
UniProt Protein Name
Homeobox protein SIX6
Protein Family
UniProt Gene Name
SIX6
UniProt Synonym Gene Names
OPTX2; SIX9
UniProt Entry Name
SIX6_HUMAN

NCBI Description

The protein encoded by this gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in eye development. Defects in this gene are a cause of isolated microphthalmia with cataract type 2 (MCOPCT2). [provided by RefSeq, Jul 2008]

Uniprot Description

SIX6: May be involved in eye development. Defects in SIX6 are the cause of microphthalmia isolated with cataract type 2 (MCOPCT2). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataractand other abnormalities like cataract may also be present. Belongs to the SIX/Sine oculis homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: nucleus

Molecular Function: DNA binding

Biological Process: organ morphogenesis; visual perception; positive regulation of transcription from RNA polymerase II promoter

Disease: Microphthalmia, Isolated, With Cataract 2; Microphthalmia, Syndromic 3

Research Articles on SIX6

Similar Products

Product Notes

The SIX6 six6 (Catalog #AAA3200900) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIX6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SIX6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SIX6 six6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAACEALNKN ESVLRARAIV AFHGGNYREL YHILENHKFT KESHAKLQAL. It is sometimes possible for the material contained within the vial of "SIX6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.