Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SIDT1Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SIDT1 Polyclonal Antibody | anti-SIDT1 antibody

SIDT1 Antibody - N-terminal region

Gene Names
SIDT1; SID1; SID-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SIDT1; Polyclonal Antibody; SIDT1 Antibody - N-terminal region; anti-SIDT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PWLLLAASPGHPAKSPRQPPAPRRDPFDAARGADFDHVYSGVVNLSTENI
Sequence Length
827
Applicable Applications for anti-SIDT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SIDT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SIDT1Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SIDT1Sample Tissue: Human NCI-H226 Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-SIDT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94 kDa
NCBI Official Full Name
SID1 transmembrane family member 1 isoform 1
NCBI Official Synonym Full Names
SID1 transmembrane family member 1
NCBI Official Symbol
SIDT1
NCBI Official Synonym Symbols
SID1; SID-1
NCBI Protein Information
SID1 transmembrane family member 1
UniProt Protein Name
SID1 transmembrane family member 1
Protein Family
UniProt Gene Name
SIDT1
UniProt Entry Name
SIDT1_HUMAN

NCBI Description

The protein encoded by this gene belongs to SID1 family of transmembrane dsRNA-gated channels. Family members transport dsRNA into cells and are required for systemic RNA interference. [provided by RefSeq, May 2017]

Uniprot Description

SIDT1: Belongs to the SID1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q13.2

Cellular Component: integral to membrane

Molecular Function: RNA transmembrane transporter activity

Biological Process: dsRNA transport

Research Articles on SIDT1

Similar Products

Product Notes

The SIDT1 sidt1 (Catalog #AAA3220672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIDT1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIDT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SIDT1 sidt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PWLLLAASPG HPAKSPRQPP APRRDPFDAA RGADFDHVYS GVVNLSTENI. It is sometimes possible for the material contained within the vial of "SIDT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.