Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sideroflexin 4 antibody (MBS5301071) used at 1 ug/ml to detect target protein.)

Rabbit Sideroflexin 4 Polyclonal Antibody | anti-SFXN4 antibody

Sideroflexin 4 antibody

Gene Names
SFXN4; BCRM1; COXPD18
Applications
Western Blot
Purity
Affinity purified
Synonyms
Sideroflexin 4; Polyclonal Antibody; Sideroflexin 4 antibody; Polyclonal Sideroflexin 4; Anti-Sideroflexin 4; SFXN4; Sideroflexin -4; BCRM1; anti-SFXN4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Sideroflexin 4 antibody was raised against the C terminal of SFXN4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFXN4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
337
Applicable Applications for anti-SFXN4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.
Cross-Reactivity
Human
Immunogen
Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Sideroflexin 4 antibody (MBS5301071) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Sideroflexin 4 antibody (MBS5301071) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SFXN4 antibody
Rabbit polyclonal Sideroflexin 4 antibody raised against the C terminal of SFXN4
Product Categories/Family for anti-SFXN4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38 kDa (MW of target protein)
NCBI Official Full Name
sideroflexin-4
NCBI Official Synonym Full Names
sideroflexin 4
NCBI Official Symbol
SFXN4
NCBI Official Synonym Symbols
BCRM1; COXPD18
NCBI Protein Information
sideroflexin-4
UniProt Protein Name
Sideroflexin-4
Protein Family
UniProt Gene Name
SFXN4
UniProt Synonym Gene Names
BCRM1
UniProt Entry Name
SFXN4_HUMAN

NCBI Description

This gene encodes a member of the sideroflexin family. The encoded protein is a transmembrane protein of the inner mitochondrial membrane, and is required for mitochondrial respiratory homeostasis and erythropoiesis. Mutations in this gene are associated with mitochondriopathy and macrocytic anemia. Alternatively spliced transcript variants have been found in this gene. [provided by RefSeq, Jan 2014]

Uniprot Description

SFXN4: Potential iron transporter. Belongs to the sideroflexin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q26.11

Cellular Component: intracellular membrane-bound organelle; mitochondrial inner membrane; integral to membrane

Molecular Function: ion transmembrane transporter activity

Biological Process: iron ion homeostasis

Disease: Combined Oxidative Phosphorylation Deficiency 18

Research Articles on SFXN4

Similar Products

Product Notes

The SFXN4 sfxn4 (Catalog #AAA5301071) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Sideroflexin 4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SFXN4 sfxn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sideroflexin 4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.