Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SHCBP1L AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit SHCBP1L Polyclonal Antibody | anti-SHCBP1L antibody

SHCBP1L antibody - C-terminal region

Gene Names
SHCBP1L; GE36; C1orf14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHCBP1L; Polyclonal Antibody; SHCBP1L antibody - C-terminal region; anti-SHCBP1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITGAQGAGVELYPGSIAILERNEIHHCNNLRTSNSSKSTLGGVNMKVLPA
Sequence Length
725
Applicable Applications for anti-SHCBP1L antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SHCBP1L AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-SHCBP1L AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-SHCBP1L antibody
This is a rabbit polyclonal antibody against SHCBP1L. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-SHCBP1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
testicular spindle-associated protein SHCBP1L isoform 1
NCBI Official Synonym Full Names
SHC binding and spindle associated 1 like
NCBI Official Symbol
SHCBP1L
NCBI Official Synonym Symbols
GE36; C1orf14
NCBI Protein Information
testicular spindle-associated protein SHCBP1L
UniProt Protein Name
Testicular spindle-associated protein SHCBP1L
UniProt Gene Name
SHCBP1L

NCBI Description

This gene encodes a Src homology 2 domain-binding protein 1-like protein. The encoded protein interacts with heat shock 70 kDa protein 2 and may be involved in maintaining spindle integrity during meiosis. This gene is located in region of chromoso0me 1 encompassing a prostate cancer susceptibility locus. [provided by RefSeq, Sep 2016]

Uniprot Description

Testis-specific spindle-associated factor that plays a role in spermatogenesis. In association with HSPA2, participates in the maintenance of spindle integrity during meiosis in male germ cells.

Research Articles on SHCBP1L

Similar Products

Product Notes

The SHCBP1L shcbp1l (Catalog #AAA3211521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHCBP1L antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHCBP1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHCBP1L shcbp1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITGAQGAGVE LYPGSIAILE RNEIHHCNNL RTSNSSKSTL GGVNMKVLPA. It is sometimes possible for the material contained within the vial of "SHCBP1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.