Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit SHARPIN Polyclonal Antibody | anti-SHARPIN antibody

SHARPIN antibody - C-terminal region

Gene Names
SHARPIN; SIPL1
Reactivity
Cow, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHARPIN; Polyclonal Antibody; SHARPIN antibody - C-terminal region; anti-SHARPIN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP
Sequence Length
387
Applicable Applications for anti-SHARPIN antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SHARPIN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SHARPIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-SHARPIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-SHARPIN antibody
This is a rabbit polyclonal antibody against SHARPIN. It was validated on Western Blot

Target Description: SHARPIN may have a role in normal immune development and control of inflammation.
Product Categories/Family for anti-SHARPIN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
sharpin
NCBI Official Synonym Full Names
SHANK associated RH domain interactor
NCBI Official Symbol
SHARPIN
NCBI Official Synonym Symbols
SIPL1
NCBI Protein Information
sharpin
UniProt Protein Name
Sharpin
Protein Family
UniProt Gene Name
SHARPIN
UniProt Synonym Gene Names
SIPL1; hSIPL1
UniProt Entry Name
SHRPN_HUMAN

Uniprot Description

Function: Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is proposed to be recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with FAM105B/otulin, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis. Ref.10 Ref.11 Ref.12

Subunit structure: Monomer and homodimer. Interacts with SHANK1, EYA1 and EYA2

By similarity. Component of the LUBAC complex (linear ubiquitin chain assembly complex) which consists of SHARPIN, RBCK1 and RNF31. LUBAC has a MW of approximative 600 kDa suggesting a heteromultimeric assembly of its subunits. Associates with the TNF-R1 signaling complex (TNF-RSC) in a stimulation-dependent manner. Ref.10 Ref.11 Ref.12 Ref.13

Subcellular location: Cytoplasm › cytosol Ref.2.

Tissue specificity: Highly expressed in skeletal muscle and placenta and at lower levels in brain, heart, colon without mucosa, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. Up-regulated in various tumor tissues such as kidney, liver, ovary and pancreas tumors. Ref.2

Domain: The Ubiquitin-like domain is required for the interaction with RNF31. Ref.10 Ref.11 Ref.12The RanBP2-type zinc fingers mediate the specific interaction with ubiquitin. Binds preferentially linear polyubiquitin chains and 'Lys-63'-linked polyubiquitin chains over 'Lys-48'-linked polyubiquitin chains. Also binds monoubiquitin. Ref.10 Ref.11 Ref.12

Sequence similarities: Contains 1 RanBP2-type zinc finger.Contains 1 ubiquitin-like domain.

Sequence caution: The sequence BAC11666.1 differs from that shown. Reason: Frameshift at position 334. The sequence BAC53797.1 differs from that shown. Reason: Frameshift at position 218. The sequence BAC53798.1 differs from that shown. Reason: Aberrant splicing.

Research Articles on SHARPIN

Similar Products

Product Notes

The SHARPIN sharpin (Catalog #AAA3214315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHARPIN antibody - C-terminal region reacts with Cow, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHARPIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHARPIN sharpin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAPREAPATG PSPQHPQKMD GELGRLFPPS LGLPPGPQPA ASSLPSPLQP. It is sometimes possible for the material contained within the vial of "SHARPIN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.