Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Sh3glb1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Rabbit Sh3glb1 Polyclonal Antibody | anti-SH3GLB1 antibody

Sh3glb1 antibody - N-terminal region

Gene Names
Sh3glb1; Bif-1; AA409932; AI314629; AU015566; mKIAA0491
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Sh3glb1; Polyclonal Antibody; Sh3glb1 antibody - N-terminal region; anti-SH3GLB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE
Sequence Length
365
Applicable Applications for anti-SH3GLB1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Sh3glb1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Western Blot (WB) (WB Suggested Anti-Sh3glb1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Related Product Information for anti-SH3GLB1 antibody
This is a rabbit polyclonal antibody against Sh3glb1. It was validated on Western Blot

Target Description: Sh3glb1 may be required for normal outer mitochondrial membrane dynamics. It is required for coatomer-mediated retrograde transport in certain cells. It may recruit other proteins to membranes with high curvature. It may promote membrane fusion.
Product Categories/Family for anti-SH3GLB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
endophilin-B1 isoform 2
NCBI Official Synonym Full Names
SH3-domain GRB2-like B1 (endophilin)
NCBI Official Symbol
Sh3glb1
NCBI Official Synonym Symbols
Bif-1; AA409932; AI314629; AU015566; mKIAA0491
NCBI Protein Information
endophilin-B1
UniProt Protein Name
Endophilin-B1
Protein Family
UniProt Gene Name
Sh3glb1
UniProt Synonym Gene Names
Kiaa0491
UniProt Entry Name
SHLB1_MOUSE

Uniprot Description

SH3GLB1: May be required for normal outer mitochondrial membrane dynamics. Required for coatomer-mediated retrograde transport in certain cells. May recruit other proteins to membranes with high curvature. May promote membrane fusion. Binds DNM1, HTT, AMPH, BIN1 and ARFGAP1. Homodimer, and heterodimer with SH3GLB2. Binds BAX. Induction of apoptosis augments BAX binding. Highly expressed in heart, skeletal muscle, kidney and placenta. Detected at lower levels in brain, colon, thymus, spleen, liver, small intestine, lung and peripheral blood leukocytes. Belongs to the endophilin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy; EC 2.3.1.-; Transferase; Apoptosis; Mitochondrial

Cellular Component: mitochondrial envelope; Golgi apparatus; mitochondrial outer membrane; protein complex; membrane; mitochondrion; endoplasmic reticulum; cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; fatty acid binding; lysophosphatidic acid acyltransferase activity; lipid binding

Biological Process: 'de novo' posttranslational protein folding; positive regulation of protein oligomerization; apoptosis; phosphatidic acid biosynthetic process; protein oligomerization; phospholipid biosynthetic process

Research Articles on SH3GLB1

Similar Products

Product Notes

The SH3GLB1 sh3glb1 (Catalog #AAA3214091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Sh3glb1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Sh3glb1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SH3GLB1 sh3glb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIMKQTEVLL QPNPNARIEE FVYEKLDRKA PSRINNPELL GQYMIDAGTE. It is sometimes possible for the material contained within the vial of "Sh3glb1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.