Immunohistochemistry (IHC)
(Rabbit Anti-SH3BGRL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Rabbit SH3BGRL Polyclonal Antibody | anti-SH3BGRL antibody
SH3BGRL antibody - middle region
Gene Names
SH3BGRL; SH3BGR; HEL-S-115
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SH3BGRL; Polyclonal Antibody; SH3BGRL antibody - middle region; anti-SH3BGRL antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Sequence Length
114
Applicable Applications for anti-SH3BGRL antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SH3BGRL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-SH3BGRL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-SH3BGRL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic in cell bodies of pinealocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Western Blot (WB)
(WB Suggested Anti-SH3BGRL Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateSH3BGRL is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Western Blot (WB)
(WB Suggested Anti-SH3BGRL Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateSH3BGRL is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-SH3BGRL antibody
This is a rabbit polyclonal antibody against SH3BGRL. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
Target Description: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
Product Categories/Family for anti-SH3BGRL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
SH3 domain-binding glutamic acid-rich-like protein
NCBI Official Synonym Full Names
SH3 domain binding glutamate rich protein like
NCBI Official Symbol
SH3BGRL
NCBI Official Synonym Symbols
SH3BGR; HEL-S-115
NCBI Protein Information
SH3 domain-binding glutamic acid-rich-like protein
UniProt Protein Name
SH3 domain-binding glutamic acid-rich-like protein
Protein Family
UniProt Gene Name
SH3BGRL
UniProt Entry Name
SH3L1_HUMAN
Uniprot Description
SH3BGRL: Belongs to the SH3BGR family.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: Xq13.3
Cellular Component: extracellular space; cytoplasm; nucleus
Molecular Function: SH3/SH2 adaptor activity; SH3 domain binding
Biological Process: positive regulation of signal transduction
Research Articles on SH3BGRL
Similar Products
Product Notes
The SH3BGRL sh3bgrl (Catalog #AAA3208926) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SH3BGRL antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SH3BGRL can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SH3BGRL sh3bgrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PQIFNESQYR GDYDAFFEAR ENNAVYAFLG LTAPPGSKEA EVQAKQQA. It is sometimes possible for the material contained within the vial of "SH3BGRL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
