Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FLJ25006 polyclonal antibody. Western Blot analysis of FLJ25006 expression in human liver.)

Mouse anti-Human SGK494 Polyclonal Antibody

SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494, MGC39533, FLJ25006)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SGK494; Polyclonal Antibody; SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494; MGC39533; FLJ25006); Anti -SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494; anti-SGK494 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FLJ25006.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGTVLKVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHLFIMCSYCSTDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDERGHLKLTDFGLSRHVPQGAQAYTICGTLQYMGERG
Applicable Applications for anti-SGK494 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FLJ25006, aa1-274 (NP_653211.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FLJ25006 polyclonal antibody. Western Blot analysis of FLJ25006 expression in human liver.)

Western Blot (WB) (FLJ25006 polyclonal antibody. Western Blot analysis of FLJ25006 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of FLJ25006 expression in transfected 293T cell line by FLJ25006 polyclonal antibody. Lane 1: FLJ25006 transfected lysate (30.14kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FLJ25006 expression in transfected 293T cell line by FLJ25006 polyclonal antibody. Lane 1: FLJ25006 transfected lysate (30.14kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SGK494 antibody
FLJ25006 likely exerts a protein serine/threonine kinase activity.
Product Categories/Family for anti-SGK494 antibody

Similar Products

Product Notes

The SGK494 (Catalog #AAA647545) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGK494 (Uncharacterized Serine/Threonine-Protein Kinase SgK494, MGC39533, FLJ25006) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGK494 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SGK494 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGAVSCRQGQ HTQQGEHTRV AVPHKQGGNI RGPWARGWKS LWTGLGTIRS DLEELWELRG HHYLHQESLK PAPVLVEKPL PEWPVPQFIN LFLPEFPIRP IRGQQQLKIL GLVAKGSFGT VLKVLDCTQK AVFAVKVVPK VKVLQRDTVR QCKEEVSIQR QINHPFVHSL GDSWQGKRHL FIMCSYCSTD LYSLWSAVGC FPEASIRLFA AELVLVLCYL HDLGIMHRDV KMENILLDER GHLKLTDFGL SRHVPQGAQA YTICGTLQYM GERG. It is sometimes possible for the material contained within the vial of "SGK494, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.