Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SFTPD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Rabbit SFTPD Polyclonal Antibody | anti-SFTPD antibody

SFTPD antibody - middle region

Gene Names
SFTPD; SP-D; PSP-D; SFTP4; COLEC7
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SFTPD; Polyclonal Antibody; SFTPD antibody - middle region; anti-SFTPD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA
Sequence Length
375
Applicable Applications for anti-SFTPD antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 85%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SFTPD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SFTPD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-SFTPD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Related Product Information for anti-SFTPD antibody
This is a rabbit polyclonal antibody against SFTPD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant. SFTPD binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieti

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
pulmonary surfactant-associated protein D
NCBI Official Synonym Full Names
surfactant protein D
NCBI Official Symbol
SFTPD
NCBI Official Synonym Symbols
SP-D; PSP-D; SFTP4; COLEC7
NCBI Protein Information
pulmonary surfactant-associated protein D
UniProt Protein Name
Pulmonary surfactant-associated protein D
UniProt Gene Name
SFTPD
UniProt Synonym Gene Names
COLEC7; PSPD; SFTP4; PSP-D; SP-D
UniProt Entry Name
SFTPD_HUMAN

NCBI Description

The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism. [provided by RefSeq, Jul 2015]

Uniprot Description

SFTPD: Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. Belongs to the SFTPD family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q22.2-q23.1

Cellular Component: extracellular space; proteinaceous extracellular matrix; collagen; lysosome; endocytic vesicle; extracellular region

Molecular Function: protein binding; carbohydrate binding

Biological Process: receptor-mediated endocytosis; negative regulation of T cell proliferation; positive regulation of phagocytosis; negative regulation of interleukin-2 biosynthetic process; defense response to bacterium; innate immune response; respiratory gaseous exchange; surfactant homeostasis; macrophage chemotaxis; alveolus development; regulation of cytokine production

Research Articles on SFTPD

Similar Products

Product Notes

The SFTPD sftpd (Catalog #AAA3205895) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFTPD antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SFTPD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SFTPD sftpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPGPPGVPGP AGREGPLGKQ GNIGPQGKPG PKGEAGPKGE VGAPGMQGSA. It is sometimes possible for the material contained within the vial of "SFTPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.