Rabbit anti-Human SFTPB Polyclonal Antibody | anti-SFTPB antibody

SFTPB (SFTP3, Pulmonary Surfactant-associated Protein B, 18kD Pulmonary-surfactant Protein, 6kD Protein, Pulmonary Surfactant-associated Proteolipid SPL(Phe)) APC

Cat. Num. AAA6393938

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SFTPB; Polyclonal Antibody; SFTPB (SFTP3; Pulmonary Surfactant-associated Protein B; 18kD Pulmonary-surfactant Protein; 6kD Protein; Pulmonary Surfactant-associated Proteolipid SPL(Phe)) APC; anti-SFTPB antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SFTPB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 381

• Applicable Applications for anti-SFTPB antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length protein corresponding to aa1-381 from human SFTPB (NP_000533.2; NM_000542.2).
• Immunogen Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SFTPB expression in human pancreas usingMBS6007970.)

Western Blot (WB)

(Western Blot analysis of SFTPB expression in transfected 293T cell line usingMBS6007970. Lane 1: SFTPB transfected lysate (42.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SFTPB antibody

This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.

Product Categories/Family for anti-SFTPB antibody

Antibodies; Pulmonary Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33943099
• NCBI Accession #: NP_000533.2
• NCBI GenBank Nucleotide #: NM_000542.2
• NCBI Official Full Name: surfactant, pulmonary-associated protein B
• Protein Family: Pulmonary surfactant-associated protein