Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SFNSample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SFN Polyclonal Antibody | anti-SFN antibody

SFN Antibody - N-terminal region

Gene Names
SFN; YWHAS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SFN; Polyclonal Antibody; SFN Antibody - N-terminal region; anti-SFN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDA
Sequence Length
248
Applicable Applications for anti-SFN antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SFNSample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SFNSample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SFN antibody
This is a rabbit polyclonal antibody against SFN. It was validated on Western Blot

Target Description: SFN is a p53-regulated inhibitor of G2/M progression. It is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. It binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. It may also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
14-3-3 protein sigma
NCBI Official Synonym Full Names
stratifin
NCBI Official Symbol
SFN
NCBI Official Synonym Symbols
YWHAS
NCBI Protein Information
14-3-3 protein sigma
UniProt Protein Name
14-3-3 protein sigma
Protein Family
UniProt Gene Name
SFN
UniProt Synonym Gene Names
HME1
UniProt Entry Name
1433S_HUMAN

NCBI Description

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017]

Uniprot Description

14-3-3 sigma: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. Homodimer. Interacts with KRT17 and SAMSN1. Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, VPS35 and SFN. Interacts with GAB2. Interacts with SRPK2. Present mainly in tissues enriched in stratified squamous keratinizing epithelium. Belongs to the 14-3-3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: extracellular space; cytoplasmic vesicle membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein kinase C inhibitor activity; protein domain specific binding; protein binding; phosphoprotein binding; protein kinase binding

Biological Process: positive regulation of protein export from nucleus; regulation of epidermal cell division; release of cytochrome c from mitochondria; DNA damage response, signal transduction resulting in induction of apoptosis; apoptosis; keratinization; positive regulation of epidermal cell differentiation; negative regulation of protein kinase activity; regulation of cyclin-dependent protein kinase activity; negative regulation of caspase activity; signal transduction; positive regulation of cell growth

Research Articles on SFN

Similar Products

Product Notes

The SFN sfn (Catalog #AAA3219184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFN Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SFN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SFN sfn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEQKSNEEGS EEKGPEVREY REKVETELQG VCDTVLGLLD SHLIKEAGDA. It is sometimes possible for the material contained within the vial of "SFN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.