Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit SERTAD1 Polyclonal Antibody | anti-SERTAD1 antibody

SERTAD1 antibody - N-terminal region

Gene Names
SERTAD1; SEI1; TRIPBR1; TRIP-Br1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SERTAD1; Polyclonal Antibody; SERTAD1 antibody - N-terminal region; anti-SERTAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSV
Sequence Length
236
Applicable Applications for anti-SERTAD1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 90%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERTAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(WB Suggested Anti-SERTAD1 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-SERTAD1 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-SERTAD1 antibody
This is a rabbit polyclonal antibody against SERTAD1. It was validated on Western Blot and immunohistochemistry

Target Description: SERTA is a transcriptional regulator that interacts with the PHD-bromodomain of co-repressors of Kruppel-associated box (KRAB)-mediated repression, KRIP-1(TIF1beta) and TIF1alpha, as well as the co-activator/adaptor p300/CBP. It is a component of a multiprotein complex containing E2F-1 and DP-1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
SERTA domain-containing protein 1
NCBI Official Synonym Full Names
SERTA domain containing 1
NCBI Official Symbol
SERTAD1
NCBI Official Synonym Symbols
SEI1; TRIPBR1; TRIP-Br1
NCBI Protein Information
SERTA domain-containing protein 1
UniProt Protein Name
SERTA domain-containing protein 1
UniProt Gene Name
SERTAD1
UniProt Synonym Gene Names
SEI1; SEI-1; TRIP-Br1
UniProt Entry Name
SRTD1_HUMAN

Uniprot Description

SERTAD1: Acts at E2F-responsive promoters to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. Stimulates E2F-1/DP-1 transcriptional activity. Renders the activity of cyclin D1/CDK4 resistant to the inhibitory effects of p16(INK4a).

Protein type: Cell cycle regulation; Transcription regulation

Chromosomal Location of Human Ortholog: 19q13.1-q13.2

Molecular Function: protein binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; regulation of cyclin-dependent protein kinase activity

Research Articles on SERTAD1

Similar Products

Product Notes

The SERTAD1 sertad1 (Catalog #AAA3201979) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERTAD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SERTAD1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SERTAD1 sertad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLSKGLKRKR EEEEEKEPLA VDSWWLDPGH TAVAQAPPAV ASSSLFDLSV. It is sometimes possible for the material contained within the vial of "SERTAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.