Western Blot (WB)
(WB Suggested Anti-SERTAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Rabbit SERTAD1 Polyclonal Antibody | anti-SERTAD1 antibody
SERTAD1 antibody - N-terminal region
Gene Names
SERTAD1; SEI1; TRIPBR1; TRIP-Br1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERTAD1; Polyclonal Antibody; SERTAD1 antibody - N-terminal region; anti-SERTAD1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAPPAVASSSLFDLSVLKLHHSLQQSEPDLRHLVLVVNTLRRIQASMAPA
Sequence Length
236
Applicable Applications for anti-SERTAD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERTAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SERTAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-SERTAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-SERTAD1 antibody
This is a rabbit polyclonal antibody against SERTAD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SERTA is a transcriptional regulator that interacts with the PHD-bromodomain of co-repressors of Kruppel-associated box (KRAB)-mediated repression, KRIP-1(TIF1beta) and TIF1alpha, as well as the co-activator/adaptor p300/CBP. It is a component of a multiprotein complex containing E2F-1 and DP-1.
Target Description: SERTA is a transcriptional regulator that interacts with the PHD-bromodomain of co-repressors of Kruppel-associated box (KRAB)-mediated repression, KRIP-1(TIF1beta) and TIF1alpha, as well as the co-activator/adaptor p300/CBP. It is a component of a multiprotein complex containing E2F-1 and DP-1.
Product Categories/Family for anti-SERTAD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
SERTA domain-containing protein 1
NCBI Official Synonym Full Names
SERTA domain containing 1
NCBI Official Symbol
SERTAD1
NCBI Official Synonym Symbols
SEI1; TRIPBR1; TRIP-Br1
NCBI Protein Information
SERTA domain-containing protein 1
UniProt Protein Name
SERTA domain-containing protein 1
Protein Family
UniProt Gene Name
SERTAD1
UniProt Synonym Gene Names
SEI1; SEI-1; TRIP-Br1
UniProt Entry Name
SRTD1_HUMAN
Uniprot Description
SERTAD1: Acts at E2F-responsive promoters to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. Stimulates E2F-1/DP-1 transcriptional activity. Renders the activity of cyclin D1/CDK4 resistant to the inhibitory effects of p16(INK4a).
Protein type: Cell cycle regulation; Transcription regulation
Chromosomal Location of Human Ortholog: 19q13.1-q13.2
Molecular Function: protein binding
Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; regulation of cyclin-dependent protein kinase activity
Research Articles on SERTAD1
Similar Products
Product Notes
The SERTAD1 sertad1 (Catalog #AAA3201980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERTAD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SERTAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERTAD1 sertad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAPPAVASSS LFDLSVLKLH HSLQQSEPDL RHLVLVVNTL RRIQASMAPA. It is sometimes possible for the material contained within the vial of "SERTAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
