Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :SERPINH1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :SERPINH1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit SERPINH1 Polyclonal Antibody | anti-SERPINH1 antibody

SERPINH1 antibody - C-terminal region

Gene Names
SERPINH1; CBP1; CBP2; OI10; gp46; AsTP3; HSP47; PIG14; PPROM; RA-A47; SERPINH2
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Applications
Immunoprecipitation, Western Blot
Purity
Protein A purified
Synonyms
SERPINH1; Polyclonal Antibody; SERPINH1 antibody - C-terminal region; anti-SERPINH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL
Sequence Length
418
Applicable Applications for anti-SERPINH1 antibody
Immunoprecipitation (IP), Western Blot (WB)
Homology
Dog: 91%; Horse: 91%; Human: 91%; Mouse: 91%; Pig: 91%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunoprecipitation (IP)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :SERPINH1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :SERPINH1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :SERPINH1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :SERPINH1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(Host: RabbitTarget Name: SERPINH1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SERPINH1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SERPINH1 AntibodyTitration: 1.25ug/mlPositive Control: Placenta cell lysate)

Western Blot (WB) (WB Suggested Anti-SERPINH1 AntibodyTitration: 1.25ug/mlPositive Control: Placenta cell lysate)
Related Product Information for anti-SERPINH1 antibody
This is a rabbit polyclonal antibody against SERPINH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Product Categories/Family for anti-SERPINH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
871
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
serpin H1
NCBI Official Synonym Full Names
serpin family H member 1
NCBI Official Symbol
SERPINH1
NCBI Official Synonym Symbols
CBP1; CBP2; OI10; gp46; AsTP3; HSP47; PIG14; PPROM; RA-A47; SERPINH2
NCBI Protein Information
serpin H1
UniProt Protein Name
Serpin H1
Protein Family
UniProt Gene Name
SERPINH1
UniProt Synonym Gene Names
CBP1; CBP2; HSP47; SERPINH2; AsTP3; Colligin
UniProt Entry Name
SERPH_HUMAN

NCBI Description

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, May 2011]

Uniprot Description

SERPINH1: Binds specifically to collagen. Could be involved as a chaperone in the biosynthetic pathway of collagen. Defects in SERPINH1 are the cause of osteogenesis imperfecta type 10 (OI10). A connective tissue disorder characterized by bone fragility, low bone mass, bowing of limbs due to multiple fractures, short limb dwarfism and blue sclerae. Belongs to the serpin family.

Chromosomal Location of Human Ortholog: 11q13.5

Cellular Component: extracellular space; endoplasmic reticulum; endoplasmic reticulum lumen; ER-Golgi intermediate compartment

Molecular Function: serine-type endopeptidase inhibitor activity; collagen binding; unfolded protein binding

Biological Process: extracellular matrix organization and biogenesis; collagen fibril organization; protein maturation; collagen biosynthetic process; response to unfolded protein

Disease: Osteogenesis Imperfecta, Type X; Preterm Premature Rupture Of The Membranes

Research Articles on SERPINH1

Similar Products

Product Notes

The SERPINH1 serpinh1 (Catalog #AAA3224426) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINH1 antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINH1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the SERPINH1 serpinh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DIYGREELRS PKLFYADHPF IFLVRDTQSG SLLFIGRLVR LKGDKMRDEL. It is sometimes possible for the material contained within the vial of "SERPINH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.