Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPB9Sample Tissue: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SERPINB9 Polyclonal Antibody | anti-SERPINB9 antibody

SERPINB9 Antibody - C-terminal region

Gene Names
SERPINB9; PI9; CAP3; PI-9; CAP-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SERPINB9; Polyclonal Antibody; SERPINB9 Antibody - C-terminal region; anti-SERPINB9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL
Sequence Length
376
Applicable Applications for anti-SERPINB9 antibody
Western Blot (WB)
Homology
Cow: 75%; Dog: 75%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SPB9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPB9Sample Tissue: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPB9Sample Tissue: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SERPINB9 antibody
This is a rabbit polyclonal antibody against SERPINB9. It was validated on Western Blot

Target Description: This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.
Product Categories/Family for anti-SERPINB9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
serpin B9
NCBI Official Synonym Full Names
serpin family B member 9
NCBI Official Symbol
SERPINB9
NCBI Official Synonym Symbols
PI9; CAP3; PI-9; CAP-3
NCBI Protein Information
serpin B9
UniProt Protein Name
Serpin B9
Protein Family
UniProt Gene Name
SERPINB9
UniProt Synonym Gene Names
PI9; CAP-3; CAP3; PI-9
UniProt Entry Name
SPB9_HUMAN

NCBI Description

This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2012]

Uniprot Description

SERPINB9: Granzyme B inhibitor. Belongs to the serpin family. Ov-serpin subfamily.

Chromosomal Location of Human Ortholog: 6p25

Cellular Component: extracellular space; membrane; cytoplasm; intracellular; nucleus; cytosol

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; protease binding; caspase inhibitor activity

Biological Process: mast cell mediated immunity; response to bacterium; immune response; negative regulation of caspase activity; negative regulation by symbiont of host apoptosis; protection from natural killer cell mediated cytotoxicity; negative regulation of apoptosis

Research Articles on SERPINB9

Similar Products

Product Notes

The SERPINB9 serpinb9 (Catalog #AAA3214217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB9 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINB9 serpinb9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTAWTKPDCM KSTEVEVLLP KFKLQEDYDM ESVLRHLGIV DAFQQGKADL. It is sometimes possible for the material contained within the vial of "SERPINB9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.