Rabbit anti-Human SERPINB8 Polyclonal Antibody | anti-SERPINB8 antibody

SERPINB8 (Serine/Cysteine Proteinase Inhibitor, Clade B, Member 8, NK10, PI8)

Cat. Num. AAA6009119

• Gene Names: SERPINB8; PI8; CAP2
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SERPINB8; Polyclonal Antibody; SERPINB8 (Serine/Cysteine Proteinase Inhibitor; Clade B; Member 8; NK10; PI8); Anti -SERPINB8 (Serine/Cysteine Proteinase Inhibitor; anti-SERPINB8 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SERPINB8.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE

• Applicable Applications for anti-SERPINB8 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human SERPINB8, aa1-242 (NP_001027018.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SERPINB8 expression in transfected 293T cell line by SERPINB8 polyclonal antibody. Lane 1: SERPINB8 transfected lysate (27.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SERPINB8 antibody

Serpin B8 is a 42-45kD, cytoplasmic and secreted member of the ovalbumin (clade B)-subfamily, Serpin superfamily of protease inhibitors. It is produced by multiple cell types and shows inhibitory activity towards furin and possibly other proteinases such as chymotrypsin. Mouse Serpin B8 is 374aa in length. Although it has no signal sequence, it is likely to be released by platelets. The active inhibitory site lies between Arg336 and Arg342. One potential isoform shows a 4aa substitution for the C-terminal 133aa. Full length mouse Serpin B8 shares 78% and 91% aa identity with human and rat Serpin B8, respectively.

Product Categories/Family for anti-SERPINB8 antibody

Antibodies; Abs to Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 451770404
• NCBI GeneID: 5271
• NCBI Accession #: NP_001263419.1
• NCBI GenBank Nucleotide #: NM_001276490.1
• UniProt Accession #: P50452; Q7Z2V6; Q8N178
• Molecular Weight: 42,767 Da
• NCBI Official Full Name: serpin B8 isoform c
• NCBI Official Synonym Full Names: serpin peptidase inhibitor, clade B (ovalbumin), member 8
• NCBI Official Symbol: SERPINB8
• NCBI Official Synonym Symbols: PI8; CAP2
• NCBI Protein Information: serpin B8; PI-8; peptidase inhibitor 8; cytoplasmic antiproteinase 2; protease inhibitor 8 (ovalbumin type); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8
• UniProt Protein Name: Serpin B8
• Protein Family: Serpin
• UniProt Gene Name: SERPINB8
• UniProt Synonym Gene Names: PI8; CAP-2; CAP2; PI-8
• UniProt Entry Name: SPB8_HUMAN

NCBI Description

The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. Serpins are characterized by well-conserved a tertiary structure that consists of 3 beta sheets and 8 or 9 alpha helices (Huber and Carrell, 1989 [PubMed 2690952]). A critical portion of the molecule, the reactive center loop connects beta sheets A and C. Protease inhibitor-8 (PI8; SERPINB8) is a member of the ov-serpin subfamily, which, relative to the archetypal serpin PI1 (MIM 107400), is characterized by a high degree of homology to chicken ovalbumin, lack of N- and C-terminal extensions, absence of a signal peptide, and a serine rather than an asparagine residue at the penultimate position (summary by Bartuski et al., 1997 [PubMed 9268635]).[supplied by OMIM, Jan 2010]

Uniprot Description

SERPINB8: Belongs to the serpin family. Ov-serpin subfamily. 2 isoforms of the human protein are produced by alternative splicing

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 18q22.1

Cellular Component: extracellular space; cytosol

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding