Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SERPINB8 expression in transfected 293T cell line by SERPINB8 polyclonal antibody. Lane 1: SERPINB8 transfected lysate (27.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SERPINB8 Polyclonal Antibody | anti-SERPINB8 antibody

SERPINB8 (Serine/Cysteine Proteinase Inhibitor, Clade B, Member 8, NK10, PI8) (HRP)

Gene Names
SERPINB8; PI8; CAP2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERPINB8; Polyclonal Antibody; SERPINB8 (Serine/Cysteine Proteinase Inhibitor; Clade B; Member 8; NK10; PI8) (HRP); anti-SERPINB8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SERPINB8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-SERPINB8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SERPINB8, aa1-242 (NP_001027018.1).
Immunogen Sequence
MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SERPINB8 expression in transfected 293T cell line by SERPINB8 polyclonal antibody. Lane 1: SERPINB8 transfected lysate (27.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SERPINB8 expression in transfected 293T cell line by SERPINB8 polyclonal antibody. Lane 1: SERPINB8 transfected lysate (27.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SERPINB8 antibody
Serpin B8 is a 42-45kD, cytoplasmic and secreted member of the ovalbumin (clade B)-subfamily, Serpin superfamily of protease inhibitors. It is produced by multiple cell types and shows inhibitory activity towards furin and possibly other proteinases such as chymotrypsin. Mouse Serpin B8 is 374aa in length. Although it has no signal sequence, it is likely to be released by platelets. The active inhibitory site lies between Arg336 and Arg342. One potential isoform shows a 4aa substitution for the C-terminal 133aa. Full length mouse Serpin B8 shares 78% and 91% aa identity with human and rat Serpin B8, respectively.
Product Categories/Family for anti-SERPINB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
374
NCBI Official Full Name
serpin B8 isoform b
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade B (ovalbumin), member 8
NCBI Official Symbol
SERPINB8
NCBI Official Synonym Symbols
PI8; CAP2
NCBI Protein Information
serpin B8; PI-8; peptidase inhibitor 8; cytoplasmic antiproteinase 2; protease inhibitor 8 (ovalbumin type); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8
UniProt Protein Name
Serpin B8
Protein Family
UniProt Gene Name
SERPINB8
UniProt Synonym Gene Names
PI8; CAP-2; CAP2; PI-8
UniProt Entry Name
SPB8_HUMAN

Similar Products

Product Notes

The SERPINB8 serpinb8 (Catalog #AAA6393787) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB8 (Serine/Cysteine Proteinase Inhibitor, Clade B, Member 8, NK10, PI8) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINB8 serpinb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINB8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.