Western Blot (WB)
(Host: RabbitTarget Name: SERINC4Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Rabbit SERINC4 Polyclonal Antibody | anti-SERINC4 antibody
SERINC4 Antibody - middle region
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERINC4; Polyclonal Antibody; SERINC4 Antibody - middle region; anti-SERINC4 antibody
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVKVYSYEFQKPSLCFCCPETVEADKGQRGGAARPADQETPPAPPVQVQH
Sequence Length
274
Applicable Applications for anti-SERINC4 antibody
Western Blot (WB)
Homology
Horse: 77%; Human: 100%; Rabbit: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SERINC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SERINC4Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SERINC4Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SERINC4 antibody
This is a rabbit polyclonal antibody against SERINC4. It was validated on Western Blot
Target Description: SERINC4 incorporates a polar amino acid serine into membranes and facilitates the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids.
Target Description: SERINC4 incorporates a polar amino acid serine into membranes and facilitates the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids.
Product Categories/Family for anti-SERINC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
serine incorporator 4 isoform 3
NCBI Official Synonym Full Names
serine incorporator 4
NCBI Official Symbol
SERINC4
NCBI Protein Information
serine incorporator 4
UniProt Protein Name
Serine incorporator 4
Protein Family
UniProt Gene Name
SERINC4
UniProt Entry Name
SERC4_HUMAN
Uniprot Description
SERINC4: Incorporates a polar amino acid serine into membranes and facilitates the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids. Belongs to the TDE1 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 15q15.3
Cellular Component: integral to membrane
Molecular Function: L-serine transmembrane transporter activity
Biological Process: L-serine transport; phospholipid biosynthetic process
Similar Products
Product Notes
The SERINC4 serinc4 (Catalog #AAA3218929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERINC4 Antibody - middle region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SERINC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERINC4 serinc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVKVYSYEFQ KPSLCFCCPE TVEADKGQRG GAARPADQET PPAPPVQVQH. It is sometimes possible for the material contained within the vial of "SERINC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
