Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Septin 12 antibody (MBS839555) used at 1 ug/ml to detect target protein.)

Rabbit Septin 12 Polyclonal Antibody | anti-SEPT12 antibody

Septin 12 antibody

Gene Names
SEPT12; SPGF10
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Septin 12; Polyclonal Antibody; Septin 12 antibody; Polyclonal Septin 12; Anti-Septin 12; FLJ25410; Septin -12; 41153; anti-SEPT12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Septin 12 antibody was raised against the middle region of 40433
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 41153 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
358
Applicable Applications for anti-SEPT12 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Septin 12 antibody (MBS839555) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Septin 12 antibody (MBS839555) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SEPT12 antibody
Rabbit polyclonal Septin 12 antibody raised against the middle region of 40433
Product Categories/Family for anti-SEPT12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
Septin 12
NCBI Official Synonym Full Names
septin 12
NCBI Official Symbol
SEPT12
NCBI Official Synonym Symbols
SPGF10
NCBI Protein Information
septin-12
UniProt Protein Name
Septin-12
UniProt Gene Name
SEPT12
UniProt Entry Name
SEP12_HUMAN

NCBI Description

This gene encodes a guanine-nucleotide binding protein and member of the septin family of cytoskeletal GTPases. Septins play important roles in cytokinesis, exocytosis, embryonic development, and membrane dynamics. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

SEPT12: Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). Defects in SEPT12 are the cause of spermatogenic failure 10 (SPGF10). An infertility disorder caused by spermatogenesis defects. It results in decreased sperm motility, concentration, and multiple sperm structural defects. The most prominent feature is a defective sperm annulus, a ring structure that demarcates the midpiece and the principal piece of the sperm tail. Belongs to the septin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Cell cycle regulation; Hydrolase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: microtubule cytoskeleton; perinuclear region of cytoplasm; stress fiber; spindle; midbody; cleavage furrow

Molecular Function: protein binding; GDP binding; protein homodimerization activity; GTP binding; phosphoinositide binding

Biological Process: cell division; cell cycle

Disease: Spermatogenic Failure 10

Research Articles on SEPT12

Similar Products

Product Notes

The SEPT12 sept12 (Catalog #AAA839555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Septin 12 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Septin 12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SEPT12 sept12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Septin 12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.