Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SENP7Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SENP7 Polyclonal Antibody | anti-SENP7 antibody

SENP7 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SENP7; Polyclonal Antibody; SENP7 Antibody - middle region; anti-SENP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEGPVEHKSSEILKLQSKQDRETTNENESTSESALLELPLITCESVQMSS
Sequence Length
984
Applicable Applications for anti-SENP7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SENP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SENP7Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SENP7Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SENP7 antibody
The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for many cellular processes. SUMO-specific proteases, such as SENP7, process SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also display isopeptidase activity for deconjugation of SUMO-conjugated substrates.
Product Categories/Family for anti-SENP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108 kDa
NCBI Official Full Name
sentrin-specific protease 7 isoform 2
NCBI Official Synonym Full Names
SUMO specific peptidase 7
NCBI Official Symbol
SENP7
NCBI Protein Information
sentrin-specific protease 7
UniProt Protein Name
Sentrin-specific protease 7
Protein Family
UniProt Gene Name
SENP7
UniProt Synonym Gene Names
KIAA1707; SSP2; SUSP2
UniProt Entry Name
SENP7_HUMAN

NCBI Description

The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for many cellular processes. SUMO-specific proteases, such as SENP7, process SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also display isopeptidase activity for deconjugation of SUMO-conjugated substrates (Lima and Reverter, 2008 [PubMed 18799455]).[supplied by OMIM, Jun 2009]

Uniprot Description

SENP7: Protease that deconjugates SUMO2 and SUMO3 from targeted proteins, but not SUMO1. Catalyzes the deconjugation of poly-SUMO2 and poly-SUMO3 chains. Has very low efficiency in processing full- length SUMO proteins to their mature forms. Belongs to the peptidase C48 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.68; Protease

Chromosomal Location of Human Ortholog: 3q12

Cellular Component: intracellular; nucleus

Molecular Function: protein binding; cysteine-type peptidase activity

Biological Process: proteolysis

Research Articles on SENP7

Similar Products

Product Notes

The SENP7 senp7 (Catalog #AAA3224110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SENP7 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SENP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SENP7 senp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEGPVEHKSS EILKLQSKQD RETTNENEST SESALLELPL ITCESVQMSS. It is sometimes possible for the material contained within the vial of "SENP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.