Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human SEMA5B Polyclonal Antibody | anti-SEMA5B antibody

SEMA5B Polyclonal Antibody

Gene Names
SEMA5B; SemG; SEMAG
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SEMA5B; Polyclonal Antibody; SEMA5B Polyclonal Antibody; SEMAG; SemG; anti-SEMA5B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASC
Sequence Length
1151
Applicable Applications for anti-SEMA5B antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human SEMA5B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type III membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-SEMA5B antibody
This gene encodes a member of the semaphorin protein family which regulates axon growth during development of the nervous system. The encoded protein has a characteristic Sema domain near the N-terminus, through which semaphorins bind to plexin, and five thrombospondin type 1 repeats in the C-terminal region of the protein. The protein product may be cleaved and exist as a secreted molecule (PMID: 19463192). Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SEMA5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
119kDa/123kDa/125kDa/131kDa
NCBI Official Full Name
semaphorin-5B isoform 1
NCBI Official Synonym Full Names
semaphorin 5B
NCBI Official Symbol
SEMA5B
NCBI Official Synonym Symbols
SemG; SEMAG
NCBI Protein Information
semaphorin-5B
UniProt Protein Name
Semaphorin-5B
Protein Family
UniProt Gene Name
SEMA5B
UniProt Synonym Gene Names
KIAA1445; SEMAG

NCBI Description

This gene encodes a member of the semaphorin protein family which regulates axon growth during development of the nervous system. The encoded protein has a characteristic Sema domain near the N-terminus, through which semaphorins bind to plexin, and five thrombospondin type 1 repeats in the C-terminal region of the protein. The protein product may be cleaved and exist as a secreted molecule (PMID: 19463192). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

May act as positive axonal guidance cues.

Research Articles on SEMA5B

Similar Products

Product Notes

The SEMA5B sema5b (Catalog #AAA9133836) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEMA5B Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEMA5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the SEMA5B sema5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRACENGNSC LGCGVEFKTC NPEGCPEVRR NTPWTPWLPV NVTQGGARQE QRFRFTCRAP LADPHGLQFG RRRTETRTCP ADGSGSCDTD ALVEVLLRSG STSPHTVSGG WAAWGPWSSC SRDCELGFRV RKRTCTNPEP RNGGLPCVGD AAEYQDCNPQ ACPVRGAWSC WTSWSPCSAS C. It is sometimes possible for the material contained within the vial of "SEMA5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.