Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SCT rabbit polyclonal antibody. Western Blot analysis of SCT expression in HepG2.)

Rabbit anti-Human SCT Polyclonal Antibody | anti-SCT antibody

SCT (Secretin) (AP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCT; Polyclonal Antibody; SCT (Secretin) (AP); anti-SCT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SCT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SCT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SCT, aa1-121 (NP_068739.1).
Immunogen Sequence
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SCT rabbit polyclonal antibody. Western Blot analysis of SCT expression in HepG2.)

Western Blot (WB) (SCT rabbit polyclonal antibody. Western Blot analysis of SCT expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SCT expression in transfected 293T cell line by SCT polyclonal antibody. Lane 1: SCT transfected lysate (13kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SCT expression in transfected 293T cell line by SCT polyclonal antibody. Lane 1: SCT transfected lysate (13kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SCT antibody
Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach.
Product Categories/Family for anti-SCT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,016 Da
NCBI Official Full Name
secretin preproprotein
NCBI Official Synonym Full Names
secretin
NCBI Official Symbol
SCT
NCBI Protein Information
secretin; prepro-secretin
UniProt Protein Name
Secretin
Protein Family
UniProt Gene Name
SCT
UniProt Entry Name
SECR_HUMAN

NCBI Description

Secretin belongs to the glucagon family. This protein is an endocrine hormone and its major site of production is the endocrine S cells located in the proximal small intestinal mucosa. The release of active secretin is stimulated by either fatty acids or an acidic pH in the duodenum. This hormone stimulates the secretion of bicarbonate-rich pancreatic fluids and has also been shown to regulate the growth and development of the stomach, small intestine, and pancreas. Secretin deficiency has been implicated in autistic syndrome, suggesting that the hormone could have a neuroendocrine function in addition to its role in digestion. [provided by RefSeq, Jul 2008]

Uniprot Description

SCT: Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach. Belongs to the glucagon family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: extracellular region

Molecular Function: hormone activity

Biological Process: dentate gyrus development; visual learning; negative regulation of neuron apoptosis; pancreatic juice secretion

Research Articles on SCT

Similar Products

Product Notes

The SCT sct (Catalog #AAA6393431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCT (Secretin) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCT sct for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.