Mouse anti-Human, Mouse PAGE4 Monoclonal Antibody | anti-PAGE4 antibody

PAGE4 (G Antigen Family C Member 1, PAGE-1, Prostate-associated Gene 4 Protein, PAGE-4, GAGEC1, JM27) (FITC)

Cat. Num. AAA6148651

• Gene Names: PAGE4; JM27; JM-27; CT16.7; GAGE-9; GAGEC1; PAGE-1; PAGE-4
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PAGE4; Monoclonal Antibody; PAGE4 (G Antigen Family C Member 1; PAGE-1; Prostate-associated Gene 4 Protein; PAGE-4; GAGEC1; JM27) (FITC); anti-PAGE4 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 7C3
• Specificity: Recognizes human PAGE4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 790

• Applicable Applications for anti-PAGE4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-102 from PAGE4 (NP_008934) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.6kD).)

Western Blot (WB)

(Western Blot analysis of PAGE4 expression in transfected 293T cell line by PAGE4 monoclonal antibody. Lane 1: PAGE4 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PAGE4 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PAGE4 antibody

PAGE4 belongs to the GAGE family of genes which are expressed in a variety of tumors and in some fetal and reproductive tissues. PAGE4 is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer.

Product Categories/Family for anti-PAGE4 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 974141109
• NCBI GeneID: 9506
• NCBI Accession #: NM_007003.4
• NCBI GenBank Nucleotide #: NM_007003
• UniProt Accession #: O60829
• NCBI Official Full Name: Homo sapiens PAGE family member 4 (PAGE4), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: PAGE family member 4
• NCBI Official Symbol: PAGE4
• NCBI Official Synonym Symbols: JM27; JM-27; CT16.7; GAGE-9; GAGEC1; PAGE-1; PAGE-4
• NCBI Protein Information: P antigen family member 4
• UniProt Protein Name: P antigen family member 4
• Protein Family: P antigen family
• UniProt Gene Name: PAGE4
• UniProt Synonym Gene Names: GAGEC1; PAGE-4
• UniProt Entry Name: PAGE4_HUMAN

NCBI Description

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

PAGE4: a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008]

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xp11.23