Western Blot (WB)
(Host: RabbitTarget Name: SCO1Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SCO1 Polyclonal Antibody | anti-SCO1 antibody
SCO1 Antibody-middle region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCO1; Polyclonal Antibody; SCO1 Antibody-middle region; protein SCO1 homolog; mitochondrial; D11Bwg1310e; 2610001C07Rik; anti-SCO1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
IATYVKEFSPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTI
Applicable Applications for anti-SCO1 antibody
Western Blot (WB)
Protein Size
284 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SCO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SCO1Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SCO1Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SCO1 antibody
Description of Target: Copper metallochaperone essential for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Not required for the synthesis of MT-CO2/COX2 but plays a crucial role in stabilizing MT-CO2/COX2 during its subsequent maturation. Involved in transporting copper to the Cu(A) site on MT-CO2/COX2 (By similarity). Plays an important role in the regulation of copper homeostasis by controlling the abundance and cell membrane localization of copper transporter CTR1.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
32kDa
UniProt Protein Name
Protein SCO1 homolog, mitochondrial
Protein Family
UniProt Gene Name
Sco1
UniProt Entry Name
SCO1_MOUSE
Similar Products
Product Notes
The SCO1 sco1 (Catalog #AAA3249748) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCO1 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SCO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCO1 sco1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IATYVKEFSP KLVGLTGTKE EIDGVARAYR VYYSPGPKDE DEDYIVDHTI. It is sometimes possible for the material contained within the vial of "SCO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
