Rabbit anti-Human, Mouse Scinderin Polyclonal Antibody | anti-SCIN antibody

Scinderin (SCIN, Adseverin, KIAA1905) (Biotin)

Cat. Num. AAA6393345

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Scinderin; Polyclonal Antibody; Scinderin (SCIN; Adseverin; KIAA1905) (Biotin); anti-SCIN antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SCIN. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 468

• Applicable Applications for anti-SCIN antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SCIN, aa1-468 (NP_149119.1).
• Immunogen Sequence: MAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFYGGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in human kidney.)

Western Blot (WB)

(SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of SCIN expression in transfected 293T cell line by SCIN polyclonal antibody. Lane 1: SCIN transfected lysate (52.8kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SCIN antibody

Antibodies; Actin Related Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 14916473
• NCBI GeneID: 85477
• NCBI Accession #: NP_149119.1
• NCBI GenBank Nucleotide #: NM_033128.1
• UniProt Accession #: Q9Y6U3
• NCBI Official Full Name: adseverin isoform 2
• NCBI Official Synonym Full Names: scinderin
• NCBI Official Symbol: SCIN
• NCBI Protein Information: adseverin
• UniProt Protein Name: Adseverin
• Protein Family: Adseverin
• UniProt Gene Name: SCIN
• UniProt Synonym Gene Names: KIAA1905
• UniProt Entry Name: ADSV_HUMAN

NCBI Description

SCIN is a Ca(2+)-dependent actin-severing and -capping protein (Zunino et al., 2001 [PubMed 11568009]).[supplied by OMIM, May 2010]

Uniprot Description

SCIN: Ca(2+)-dependent actin filament-severing protein that is presumed to have a regulatory function in exocytosis by affecting the organization of the microfilament network underneath the plasma membrane. In vitro, also has barbed end capping and nucleating activities in the presence of Ca(2+). Regulates chondrocyte proliferation and differentiation. MAP kinases p38 and ERK1/2 mediate the adseverin-induced accelerated differentiation of non-hypertrophic chondrocytes. Belongs to the villin/gelsolin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: protein complex; cytoskeleton; cytoplasm; cell cortex

Molecular Function: actin filament binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylserine binding; calcium ion binding; actin binding; phosphatidylinositol binding

Biological Process: negative regulation of cell proliferation; actin filament severing; positive regulation of apoptosis; actin filament capping; positive regulation of secretion; positive regulation of megakaryocyte differentiation; regulation of chondrocyte differentiation; actin nucleation; calcium ion-dependent exocytosis