Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in human kidney.)

Rabbit anti-Human, Mouse Scinderin Polyclonal Antibody | anti-SCIN antibody

Scinderin (SCIN, Adseverin, KIAA1905)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Scinderin; Polyclonal Antibody; Scinderin (SCIN; Adseverin; KIAA1905); Anti -Scinderin (SCIN; anti-SCIN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SCIN. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFYGGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
Applicable Applications for anti-SCIN antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SCIN, aa1-468 (NP_149119.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in human kidney.)

Western Blot (WB) (SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in human kidney.)

Western Blot (WB)

(SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in mouse kidney.)

Western Blot (WB) (SCIN rabbit polyclonal antibody. Western Blot analysis of SCIN expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of SCIN expression in transfected 293T cell line by SCIN polyclonal antibody. Lane 1: SCIN transfected lysate (52.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SCIN expression in transfected 293T cell line by SCIN polyclonal antibody. Lane 1: SCIN transfected lysate (52.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SCIN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
80,489 Da
NCBI Official Full Name
scinderin
NCBI Official Synonym Full Names
scinderin
NCBI Official Symbol
SCIN
NCBI Protein Information
adseverin
UniProt Protein Name
Adseverin
Protein Family
UniProt Gene Name
SCIN
UniProt Synonym Gene Names
KIAA1905
UniProt Entry Name
ADSV_HUMAN

NCBI Description

SCIN is a Ca(2+)-dependent actin-severing and -capping protein (Zunino et al., 2001 [PubMed 11568009]).[supplied by OMIM, May 2010]

Uniprot Description

SCIN: Ca(2+)-dependent actin filament-severing protein that is presumed to have a regulatory function in exocytosis by affecting the organization of the microfilament network underneath the plasma membrane. In vitro, also has barbed end capping and nucleating activities in the presence of Ca(2+). Regulates chondrocyte proliferation and differentiation. MAP kinases p38 and ERK1/2 mediate the adseverin-induced accelerated differentiation of non-hypertrophic chondrocytes. Belongs to the villin/gelsolin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: cytoskeleton; protein complex; cytoplasm; cell cortex

Molecular Function: actin filament binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylserine binding; calcium ion binding; actin binding; phosphatidylinositol binding

Biological Process: negative regulation of cell proliferation; actin filament severing; positive regulation of apoptosis; actin filament capping; positive regulation of secretion; positive regulation of megakaryocyte differentiation; regulation of chondrocyte differentiation; actin nucleation; calcium ion-dependent exocytosis

Research Articles on SCIN

Similar Products

Product Notes

The SCIN scin (Catalog #AAA6001815) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Scinderin (SCIN, Adseverin, KIAA1905) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Scinderin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SCIN scin for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAKLYMVSDA SGSMRVTVVA EENPFSMAML LSEECFILDH GAAKQIFVWK GKDANPQERK AAMKTAEEFL QQMNYSKNTQ IQVLPEGGET PIFKQFFKDW RDKDQSDGFG KVYVTEKVAQ IKQIPFDASK LHSSPQMAAQ HNMVDDGSGK VEIWRVENNG RIQVDQNSYG EFYGGDCYII LYTYPRGQII YTWQGANATR DELTTSAFLT VQLDRSLGGQ AVQIRVSQGK EPVHLLSLFK DKPLIIYKNG TSKKGGQAPA PPTRLFQVRR NLASITRIVE VDVDANSLNS NDVFVLKLPQ NSGYIWVGKG ASQEEEKGAE YVASVLKCKT LRIQEGEEPE EFWNSLGGKK DYQTSPLLET QAEDHPPRLY GCSNKTGRFV IEEIPGEFTQ DDLAEDDVML LDAWEQIFIW IGKDANEVEK KESLKSAKMY LETDPSGRDK RTPIVIIKQG HEPPTFTGWF LGWDSSKW. It is sometimes possible for the material contained within the vial of "Scinderin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.