Western Blot (WB)
(WB Suggested Anti-SCAMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Rabbit SCAMP3 Polyclonal Antibody | anti-SCAMP3 antibody
SCAMP3 antibody - N-terminal region
Gene Names
SCAMP3; C1orf3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCAMP3; Polyclonal Antibody; SCAMP3 antibody - N-terminal region; anti-SCAMP3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT
Sequence Length
321
Applicable Applications for anti-SCAMP3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SCAMP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SCAMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-SCAMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Related Product Information for anti-SCAMP3 antibody
This is a rabbit polyclonal antibody against SCAMP3. It was validated on Western Blot
Target Description: This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Two transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SCAMP3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
secretory carrier-associated membrane protein 3 isoform 1
NCBI Official Synonym Full Names
secretory carrier membrane protein 3
NCBI Official Symbol
SCAMP3
NCBI Official Synonym Symbols
C1orf3
NCBI Protein Information
secretory carrier-associated membrane protein 3
UniProt Protein Name
Secretory carrier-associated membrane protein 3
Protein Family
UniProt Gene Name
SCAMP3
UniProt Synonym Gene Names
C1orf3; PROPIN1
UniProt Entry Name
SCAM3_HUMAN
NCBI Description
This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]
Uniprot Description
SCAMP3: an integral membrane of the SCAMP family. Acts as a recycling carrier to the cell surface. Functions in post-Golgi recycling pathways. Two alternatively spliced isoforms have been described.
Protein type: Membrane protein, integral; Vesicle; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 1q21
Cellular Component: Golgi membrane; integral to membrane
Molecular Function: ubiquitin protein ligase binding
Biological Process: protein transport; response to retinoic acid; post-Golgi vesicle-mediated transport
Research Articles on SCAMP3
Similar Products
Product Notes
The SCAMP3 scamp3 (Catalog #AAA3214351) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCAMP3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SCAMP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCAMP3 scamp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQPPPAYEPP APAPLPPPSA PSLQPSRKLS PTEPKNYGSY STQASAAAAT. It is sometimes possible for the material contained within the vial of "SCAMP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
