Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SAP30BP Antibody Titration: 1.25ug/mlPositive Control: Human Muscle)

Rabbit SAP30BP Polyclonal Antibody | anti-SAP30BP antibody

SAP30BP antibody - C-terminal region

Gene Names
SAP30BP; HTRG; HTRP; HCNGP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
SAP30BP; Polyclonal Antibody; SAP30BP antibody - C-terminal region; anti-SAP30BP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPT
Sequence Length
308
Applicable Applications for anti-SAP30BP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SAP30BP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SAP30BP Antibody Titration: 1.25ug/mlPositive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-SAP30BP Antibody Titration: 1.25ug/mlPositive Control: Human Muscle)
Related Product Information for anti-SAP30BP antibody
This is a rabbit polyclonal antibody against SAP30BP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SAP30BP is a component of a histone deacetylase complex conserved among eukaryotic organisms. This complex is active in deacetylating core histone octamers, but inactive in deacetylating nucleosomal histones due to the inability of the histone binding proteins RbAp46 and RbAp48 to gain access to nucleosomal histones.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
SAP30-binding protein isoform 2
NCBI Official Synonym Full Names
SAP30 binding protein
NCBI Official Symbol
SAP30BP
NCBI Official Synonym Symbols
HTRG; HTRP; HCNGP
NCBI Protein Information
SAP30-binding protein
UniProt Protein Name
SAP30-binding protein
Protein Family
UniProt Gene Name
SAP30BP
UniProt Entry Name
S30BP_HUMAN

Research Articles on SAP30BP

Similar Products

Product Notes

The SAP30BP sap30bp (Catalog #AAA3204398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAP30BP antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SAP30BP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAP30BP sap30bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEFVTGTKKG TTTNATSTTT TTASTAVADA QKRKSKWDSA IPVTTIAQPT. It is sometimes possible for the material contained within the vial of "SAP30BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.