Rabbit anti-Human SAA4 Polyclonal Antibody | anti-SAA4 antibody

SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) (Biotin)

Cat. Num. AAA6393224

• Gene Names: SAA4; CSAA; C-SAA
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SAA4; Polyclonal Antibody; SAA4 (CSAA; Serum Amyloid A-4 Protein; Constitutively Expressed Serum Amyloid A Protein; C-SAA) (Biotin); anti-SAA4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SAA4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SAA4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SAA4, aa1-130 (NP_006503.1).
• Immunogen Sequence: MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SAA4 rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of SAA4 expression in transfected 293T cell line by SAA4 polyclonal antibody. Lane 1: SAA4 transfected lysate (14.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SAA4 antibody

SAA4 is a constitutively expressed protein belonging to the SAA family. It is a major acute phase reactant and an apolipoprotein of the HDL complex. SAA4 is constitutively expressed only in humans and mice, is associated almost entirely with lipoproteins of the high density range. Its physiological function is unknown and its serum concentration has no relationship with those of other major apolipoproteins. The presence of SAA4 mRNA and protein in macrophage derived foam cells of coronary and carotid arteries suggested a specific role of human SAA4 during inflammation including atherosclerosis.

Product Categories/Family for anti-SAA4 antibody

Antibodies; Amyloid

NCBI and Uniprot Product Information

• NCBI GI #: 10835095
• NCBI GeneID: 6291
• NCBI Accession #: NP_006503.1
• NCBI GenBank Nucleotide #: NM_006512.1
• UniProt Accession #: P35542; Q6FHJ4
• Molecular Weight: 14,747 Da
• NCBI Official Full Name: serum amyloid A-4 protein
• NCBI Official Synonym Full Names: serum amyloid A4, constitutive
• NCBI Official Symbol: SAA4
• NCBI Official Synonym Symbols: CSAA; C-SAA
• NCBI Protein Information: serum amyloid A-4 protein; constitutively expressed serum amyloid A protein
• UniProt Protein Name: Serum amyloid A-4 protein
• Protein Family: Serum amyloid A-4 protein
• UniProt Gene Name: SAA4
• UniProt Synonym Gene Names: CSAA; C-SAA
• UniProt Entry Name: SAA4_HUMAN

Uniprot Description

SAA4: Major acute phase reactant. Apolipoprotein of the HDL complex. Belongs to the SAA family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p15.1-p14

Cellular Component: extracellular region

Biological Process: acute-phase response