Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (S100A8 rabbit polyclonal antibody. Western Blot analysis of S100A8 expression in human spleen.)

Rabbit anti-Human S100A8 Polyclonal Antibody | anti-S100A8 antibody

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF

Gene Names
S100A8; P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
S100A8; Polyclonal Antibody; S100A8 (S100 Calcium Binding Protein A8; 60B8AG; Calgranulin-A; CAGA; CGLA; Calprotectin L1L Subunit; CP-10; Cystic Fibrosis Antigen; CFAG; L1Ag; Leukocyte L1 Complex Light Chain; MA387; MIF; Migration Inhibitory Factor-related Protein 8; MRP8; MRP-8; NIF; anti-S100A8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human S100A8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-S100A8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human S100AB, aa1-94 (AH05928).
Immunogen Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE*
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(S100A8 rabbit polyclonal antibody. Western Blot analysis of S100A8 expression in human spleen.)

Western Blot (WB) (S100A8 rabbit polyclonal antibody. Western Blot analysis of S100A8 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of S100A8 expression in transfected 293T cell line by S100A8 polyclonal antibody. Lane 1: S100A8 transfected lysate (10.34kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of S100A8 expression in transfected 293T cell line by S100A8 polyclonal antibody. Lane 1: S100A8 transfected lysate (10.34kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-S100A8 antibody
S100 Calcium Binding Protein A8 (S100A8) is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A8 may function in the inhibition of casein kinase and as a cytokine. Altered expression of S100A8 is associated with the disease cystic fibrosis.
Product Categories/Family for anti-S100A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
10,835 Da
NCBI Official Full Name
Homo sapiens S100 calcium binding protein A8, mRNA
NCBI Official Synonym Full Names
S100 calcium binding protein A8
NCBI Official Symbol
S100A8
NCBI Official Synonym Symbols
P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
NCBI Protein Information
protein S100-A8
Protein Family

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Research Articles on S100A8

Similar Products

Product Notes

The S100A8 (Catalog #AAA6393189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.