Western Blot (WB)
(Western Blot analysis of S100A7 expression in transfected 293T cell line by S100A7 MaxPab polyclonal antibody.Lane 1: S100A7 transfected lysate(11.22 KDa).Lane 2: Non-transfected lysate.)
Rabbit anti-Human S100A7 Polyclonal Antibody | anti-S100A7 antibody
S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) (Biotin)
Gene Names
S100A7; PSOR1; S100A7c
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
S100A7; Polyclonal Antibody; S100A7 (S100 Calcium Binding Protein A7; PSOR1; S100A7c) (Biotin); S100 Calcium Binding Protein A7; S100A7c; anti-S100A7 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human S100A7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-S100A7 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
S100A7 (AAH34687.1, 1aa-101aa) full-length human protein.
Immunogen Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of S100A7 expression in transfected 293T cell line by S100A7 MaxPab polyclonal antibody.Lane 1: S100A7 transfected lysate(11.22 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of S100A7 expression in transfected 293T cell line by S100A7 MaxPab polyclonal antibody.Lane 1: S100A7 transfected lysate(11.22 KDa).Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified MaxPab antibody to S100A7 on HeLa cell. [antibody concentration 20 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of purified MaxPab antibody to S100A7 on HeLa cell. [antibody concentration 20 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of purified MaxPab antibody to S100A7 on HeLa cell. [antibody concentration 20 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of purified MaxPab antibody to S100A7 on HeLa cell. [antibody concentration 20 ug/ml])
Related Product Information for anti-S100A7 antibody
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq]
Product Categories/Family for anti-S100A7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
11,471 Da
NCBI Official Full Name
S100 calcium binding protein A7
NCBI Official Synonym Full Names
S100 calcium binding protein A7
NCBI Official Symbol
S100A7
NCBI Official Synonym Symbols
PSOR1; S100A7c
NCBI Protein Information
protein S100-A7; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1)
Protein Family
Similar Products
Product Notes
The S100A7 (Catalog #AAA6451588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A7 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
