Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RUNX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit RUNX2 Polyclonal Antibody | anti-RUNX2 antibody

RUNX2 antibody - middle region

Gene Names
RUNX2; CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
RUNX2; Polyclonal Antibody; RUNX2 antibody - middle region; anti-RUNX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDRLSDLGRIPHPSMR
Sequence Length
589
Applicable Applications for anti-RUNX2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RUNX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RUNX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-RUNX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RUNX2 antibody
This is a rabbit polyclonal antibody against RUNX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The RUNX2 gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
860
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
Runt-related transcription factor 2
NCBI Official Synonym Full Names
runt related transcription factor 2
NCBI Official Symbol
RUNX2
NCBI Official Synonym Symbols
CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
NCBI Protein Information
runt-related transcription factor 2
UniProt Protein Name
Runt-related transcription factor 2
UniProt Gene Name
RUNX2
UniProt Synonym Gene Names
AML3; CBFA1; OSF2; PEBP2A; CBF-alpha-1; OSF-2; PEA2-alpha A; PEBP2-alpha A
UniProt Entry Name
RUNX2_HUMAN

NCBI Description

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Two regions of potential trinucleotide repeat expansions are present in the N-terminal region of the encoded protein, and these and other mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq, Jul 2016]

Uniprot Description

AML3: Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis. Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'- PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation: synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE). Inhibits KAT6B-dependent transcriptional activation. Interaction with SATB2 results in enhanced DNA binding and transactivation by these transcription factors. Heterodimer of an alpha and a beta subunit. Interacts with HIVEP3 and HIPK3. The alpha subunit binds DNA as a monomer and through the Runt domain. DNA-binding is increased by heterodimerization. Interacts with XRCC6 (Ku70) and XRCC5 (Ku80). Interacts with KAT6A and KAT6B. Binds to cyclin B1 CCNB1. Interacts with DDX5. Specifically expressed in osteoblasts. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nuclear chromatin

Molecular Function: protein domain specific binding; protein binding; bHLH transcription factor binding; chromatin binding; transcription factor activity; ATP binding

Biological Process: embryonic forelimb morphogenesis; transcription initiation from RNA polymerase II promoter; ossification; positive regulation of transcription, DNA-dependent; cell maturation; regulation of fibroblast growth factor receptor signaling pathway; chondrocyte development; embryonic cranial skeleton morphogenesis; stem cell differentiation; osteoblast development; odontogenesis of dentine-containing teeth; BMP signaling pathway; osteoblast differentiation; positive regulation of osteoblast differentiation; positive regulation of chondrocyte differentiation; negative regulation of smoothened signaling pathway; positive regulation of cell proliferation; gene expression; negative regulation of transcription, DNA-dependent; regulation of odontogenesis of dentine-containing teeth; osteoblast fate commitment; T cell differentiation; endochondral ossification

Disease: Metaphyseal Dysplasia With Maxillary Hypoplasia With Or Without Brachydactyly; Cleidocranial Dysplasia

Research Articles on RUNX2

Similar Products

Product Notes

The RUNX2 runx2 (Catalog #AAA3203265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RUNX2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RUNX2 runx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YHRAIKVTVD GPREPRRHRQ KLDDSKPSLF SDRLSDRLSD LGRIPHPSMR. It is sometimes possible for the material contained within the vial of "RUNX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.