Western Blot (WB)
(WB Suggested Anti-RTN4IP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Rabbit RTN4IP1 Polyclonal Antibody | anti-RTN4IP1 antibody
RTN4IP1 antibody - middle region
Gene Names
RTN4IP1; NIMP; OPA10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RTN4IP1; Polyclonal Antibody; RTN4IP1 antibody - middle region; anti-RTN4IP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCS
Sequence Length
396
Applicable Applications for anti-RTN4IP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RTN4IP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RTN4IP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Western Blot (WB)
(WB Suggested Anti-RTN4IP1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Related Product Information for anti-RTN4IP1 antibody
This is a rabbit polyclonal antibody against RTN4IP1. It was validated on Western Blot
Target Description: This gene encodes a novel mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. The interaction of reticulon 4 with mitochondrial proteins may provide insight into the mechanisms for reticulon-induced inhibition of neurite growth.
Target Description: This gene encodes a novel mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. The interaction of reticulon 4 with mitochondrial proteins may provide insight into the mechanisms for reticulon-induced inhibition of neurite growth.
Product Categories/Family for anti-RTN4IP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
reticulon-4-interacting protein 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
reticulon 4 interacting protein 1
NCBI Official Symbol
RTN4IP1
NCBI Official Synonym Symbols
NIMP; OPA10
NCBI Protein Information
reticulon-4-interacting protein 1, mitochondrial
UniProt Protein Name
Reticulon-4-interacting protein 1, mitochondrial
Protein Family
UniProt Gene Name
RTN4IP1
UniProt Synonym Gene Names
NIMP
UniProt Entry Name
RT4I1_HUMAN
NCBI Description
This gene encodes a mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. This interaction may be important for reticulon-induced inhibition of neurite growth. Mutations in this gene can cause optic atrophy 10, with or without ataxia, cognitive disability, and seizures. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Description
RTN4IP1: Appears to be a potent inhibitor of regeneration following spinal cord injury. Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Mitochondrial
Chromosomal Location of Human Ortholog: 6q21
Cellular Component: mitochondrion
Molecular Function: zinc ion binding; oxidoreductase activity
Research Articles on RTN4IP1
Similar Products
Product Notes
The RTN4IP1 rtn4ip1 (Catalog #AAA3214888) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RTN4IP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RTN4IP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RTN4IP1 rtn4ip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AWSAINKVGG LNDKNCTGKR VLILGASGGV GTFAIQVMKA WDAHVTAVCS. It is sometimes possible for the material contained within the vial of "RTN4IP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
