Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Rps6ka2Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Rps6ka2 Polyclonal Antibody | anti-RPS6KA2 antibody

Rps6ka2 Antibody - C-terminal region

Gene Names
Rps6ka2; Rsk3; 90kDa; p90rsk; pp90rsk; D17Wsu134e; Rps6ka-rs1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rps6ka2; Polyclonal Antibody; Rps6ka2 Antibody - C-terminal region; anti-RPS6KA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYF
Sequence Length
733
Applicable Applications for anti-RPS6KA2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rps6ka2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Rps6ka2Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Rps6ka2Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RPS6KA2 antibody
This is a rabbit polyclonal antibody against Rps6ka2. It was validated on Western Blot

Target Description: Rps6ka2 is a serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. May function as tumor suppressor in epithelial ovarian cancer cells.
Product Categories/Family for anti-RPS6KA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
ribosomal protein S6 kinase alpha-2
NCBI Official Synonym Full Names
ribosomal protein S6 kinase, polypeptide 2
NCBI Official Symbol
Rps6ka2
NCBI Official Synonym Symbols
Rsk3; 90kDa; p90rsk; pp90rsk; D17Wsu134e; Rps6ka-rs1
NCBI Protein Information
ribosomal protein S6 kinase alpha-2
UniProt Protein Name
Ribosomal protein S6 kinase alpha-2
UniProt Gene Name
Rps6ka2
UniProt Synonym Gene Names
Mapkapk1c; Rsk3; S6K-alpha-2; p90-RSK 2; p90RSK2; MAPK-activated protein kinase 1c; MAPKAP kinase 1c; MAPKAPK-1c; RSK-3
UniProt Entry Name
KS6A2_MOUSE

Uniprot Description

Function: Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. May function as tumor suppressor in epithelial ovarian cancer cells

By similarity.

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Cofactor: Magnesium

By similarity.

Enzyme regulation: Upon extracellular signal or mitogen stimulation, phosphorylated at Thr-570 in the C-terminal kinase domain (CTKD) by MAPK1/ERK2 and MAPK3/ERK1. The activated CTKD then autophosphorylates Ser-377, allowing binding of PDPK1, which in turn phosphorylates Ser-218 in the N-terminal kinase domain (NTDK) leading to the full activation of the protein and subsequent phosphorylation of the substrates by the NTKD.

Subunit structure: Forms a complex with either MAPK1/ERK2 or MAPK3/ERK1 in quiescent cells. Transiently dissociates following mitogenic stimulation

By similarity.

Subcellular location: Nucleus

By similarity. Cytoplasm

By similarity.

Post-translational modification: Activated by phosphorylation at Ser-218 by PDPK1. Autophosphorylated on Ser-377, as part of the activation process. May be phosphorylated at Thr-356 and Ser-360 by MAPK1/ERK2 and MAPK3/ERK1

By similarity.N-terminal myristoylation results in an activated kinase in the absence of added growth factors

By similarity.

Sequence similarities: Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.Contains 1 AGC-kinase C-terminal domain.Contains 2 protein kinase domains.

Research Articles on RPS6KA2

Similar Products

Product Notes

The RPS6KA2 rps6ka2 (Catalog #AAA3212605) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rps6ka2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rps6ka2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPS6KA2 rps6ka2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMLHVDPQQR LTAVQVLKHP WIVNREYLSQ NQLSRQDVHL VKGAMAATYF. It is sometimes possible for the material contained within the vial of "Rps6ka2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.