Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPRD1A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit RPRD1A Polyclonal Antibody | anti-RPRD1A antibody

RPRD1A antibody - N-terminal region

Gene Names
RPRD1A; P15RS; HsT3101
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPRD1A; Polyclonal Antibody; RPRD1A antibody - N-terminal region; anti-RPRD1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQA
Sequence Length
312
Applicable Applications for anti-RPRD1A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPRD1A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-RPRD1A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-RPRD1A antibody
This is a rabbit polyclonal antibody against RPRD1A. It was validated on Western Blot

Target Description: P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) and may have a role in cell cycle regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
regulation of nuclear pre-mRNA domain-containing protein 1A isoform 1
NCBI Official Synonym Full Names
regulation of nuclear pre-mRNA domain containing 1A
NCBI Official Symbol
RPRD1A
NCBI Official Synonym Symbols
P15RS; HsT3101
NCBI Protein Information
regulation of nuclear pre-mRNA domain-containing protein 1A
UniProt Protein Name
Regulation of nuclear pre-mRNA domain-containing protein 1A
UniProt Gene Name
RPRD1A
UniProt Synonym Gene Names
P15RS

NCBI Description

This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Dec 2014]

Uniprot Description

Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle.

Research Articles on RPRD1A

Similar Products

Product Notes

The RPRD1A rprd1a (Catalog #AAA3215709) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPRD1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPRD1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPRD1A rprd1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDFAPVIVEA FKHVSSETDE SCKKHLGRVL SIWEERSVYE NDVLEQLKQA. It is sometimes possible for the material contained within the vial of "RPRD1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.