Western Blot (WB)
(Western blot analysis of extracts of A431 cells, using RPP21 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 15s.)
Rabbit anti-Human, Mouse RPP21 Polyclonal Antibody | anti-RPP21 antibody
RPP21 Polyclonal Antibody
Gene Names
RPP21; CAT60; C6orf135
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RPP21; Polyclonal Antibody; RPP21 Polyclonal Antibody; C6orf135; CAT60; anti-RPP21 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
Sequence Length
162
Applicable Applications for anti-RPP21 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human RPP21
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Positive Samples
A431
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of A431 cells, using RPP21 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 15s.)
Western Blot (WB)
(Western blot analysis of extracts of A431 cells, using RPP21 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 15s.)
Product Categories/Family for anti-RPP21 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 16kDa; 17kDa; 18kDa; 20kDa
Observed: 18kDa
Observed: 18kDa
NCBI Official Full Name
ribonuclease P protein subunit p21 isoform 1
NCBI Official Synonym Full Names
ribonuclease P/MRP subunit p21
NCBI Official Symbol
RPP21
NCBI Official Synonym Symbols
CAT60; C6orf135
NCBI Protein Information
ribonuclease P protein subunit p21
UniProt Protein Name
Ribonuclease P protein subunit p21
Protein Family
UniProt Gene Name
RPP21
UniProt Synonym Gene Names
C6orf135; CAT60; RNaseP protein p21
NCBI Description
RPP21 is a protein subunit of nuclear ribonuclease P, which processes the 5-prime leader sequence of precursor tRNAs (Jarrous et al., 2001 [PubMed 11497433]).[supplied by OMIM, Jan 2009]
Uniprot Description
Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.
Research Articles on RPP21
Similar Products
Product Notes
The RPP21 rpp21 (Catalog #AAA9134427) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPP21 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RPP21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the RPP21 rpp21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGPVKDREA FQRLNFLYQA AHCVLAQDPE NQALARFYCY TERTIAKRLV LRRDPSVKRT LCRGCSSLLV PGLTCTQRQR RCRGQRWTVQ TCLTCQRSQR FLNDPGHLLW GDRPEAQLGS QADSKPLQPL PNTAHSISDR LPEEKMQTQG SSNQ. It is sometimes possible for the material contained within the vial of "RPP21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
