Rabbit anti-Mouse RPL5 Polyclonal Antibody | anti-RPL5 antibody

RPL5 Antibody-N-terminal region

Cat. Num. AAA3249684

• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: RPL5; Polyclonal Antibody; RPL5 Antibody-N-terminal region; 60S ribosomal protein L5; U21RNA; anti-RPL5 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
• Sequence: AYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI

• Applicable Applications for anti-RPL5 antibody: Western Blot (WB)
• Protein Size: 297 amino acids
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RPL5
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RPL5Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-RPL5 antibody

Description of Target: Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. As part of the 5S RNP/5S ribonucleoprotein particle it is an essential component of the LSU, required for its formation and the maturation of rRNAs. It also couples ribosome biogenesis to p53/TP53 activation. As part of the 5S RNP it accumulates in the nucleoplasm and inhibits MDM2, when ribosome biogenesis is perturbed, mediating the stabilization and the activation of TP53. Interacts with RRP1B.

NCBI and Uniprot Product Information

• NCBI GeneID: 100503670
• UniProt Accession #: P47962; NP_058676.1
• Molecular Weight: 34kDa
• UniProt Protein Name: 60S ribosomal protein L5
• Protein Family: 50S ribosomal protein
• UniProt Gene Name: Rpl5

Uniprot Description

Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. As part of the 5S RNP/5S ribonucleoprotein particle it is an essential component of the LSU, required for its formation and the maturation of rRNAs. It also couples ribosome biogenesis to p53/TP53 activation. As part of the 5S RNP it accumulates in the nucleoplasm and inhibits MDM2, when ribosome biogenesis is perturbed, mediating the stabilization and the activation of TP53. Interacts with RRP1B.