Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Arabidopsis thalianaSample Type: Arabidopsis thaliana extract (30ug)Primary Diltution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:15,000Exposure Time: 1 minuteImage Submitted By: Anonymous )

Rabbit RPL5 Polyclonal Antibody | anti-RPL5 antibody

RPL5 Antibody - N-terminal region

Gene Names
RPL5; L5; uL18; MSTP030; PPP1R135
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPL5; Polyclonal Antibody; RPL5 Antibody - N-terminal region; anti-RPL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP
Sequence Length
297
Applicable Applications for anti-RPL5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RPL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Arabidopsis thalianaSample Type: Arabidopsis thaliana extract (30ug)Primary Diltution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:15,000Exposure Time: 1 minuteImage Submitted By: Anonymous )

Western Blot (WB) (Sample Type: Arabidopsis thalianaSample Type: Arabidopsis thaliana extract (30ug)Primary Diltution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:15,000Exposure Time: 1 minuteImage Submitted By: Anonymous )

Western Blot (WB)

(WB Suggested Anti-RPL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-RPL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-RPL5 antibody
This is a rabbit polyclonal antibody against RPL5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
60S ribosomal protein L5
NCBI Official Synonym Full Names
ribosomal protein L5
NCBI Official Symbol
RPL5
NCBI Official Synonym Symbols
L5; uL18; MSTP030; PPP1R135
NCBI Protein Information
60S ribosomal protein L5
UniProt Protein Name
60S ribosomal protein L5
Protein Family
UniProt Gene Name
RPL5
UniProt Entry Name
RL5_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. [provided by RefSeq, Mar 2017]

Uniprot Description

RPL5: Required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA. Defects in RPL5 are the cause of Diamond-Blackfan anemia type 6 (DBA6). DBA6 is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies. Belongs to the ribosomal protein L18P family.

Protein type: Nucleolus; Translation; Ribosomal

Chromosomal Location of Human Ortholog: 1p22.1

Cellular Component: focal adhesion; membrane; cytoplasm; nucleolus; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding; 5S rRNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; viral reproduction; translation; translational termination; ribosomal large subunit biogenesis and assembly; viral infectious cycle; translational elongation; cellular protein metabolic process; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; rRNA processing

Disease: Diamond-blackfan Anemia 6

Research Articles on RPL5

Similar Products

Product Notes

The RPL5 rpl5 (Catalog #AAA3212574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPL5 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPL5 rpl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLVIQDKNKY NTPKYRMIVR VTNRDIICQI AYARIEGDMI VCAAYAHELP. It is sometimes possible for the material contained within the vial of "RPL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.